CAZyme Information: MGYG000002358_01182

Basic Information

• Species: Pelistega indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pelistega; Pelistega indica
• CAZyme ID: MGYG000002358_01182
• CAZy Family: GH103
• CAZyme Description: Tn3 family transposase TnXax1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000002358_74|CGC1	35304.08	9.8506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002358	2504912	Isolate	India	Asia

• Gene Location: Start: 3620; End: 4582 Strand: +

Full Sequence      

MSLVDEERVADGRAQMLTHQKTLNRIAQQYGIDPAVVVAVWGVESNFGKNQGKYSLVNAL
GTLSCMGRRQEFFRKEFFATLRIIQSGDIAADRLNGSWAGAFGHTQFMPTTFERLAVDFD
NDGRRDLIDNSVDALGSTANYLKKNGWVTGQPWGFEVKLSTNITGAGESRTNKKPISYWQ
SIGVTRVDGSPLTDTVNANQKAGLLMPAGRQGPTFLVFKNFDVIYSYNAAESYALAIAHL
ADRIKGQKPFVTPWPTDDLGLSREERKVLQQRLIDKGYNIGEVDGLLGGKTKEAIKQEQA
RLGMPVDGRAGQKLLKALQK

Enzyme Prediction     

No EC number prediction in MGYG000002358_01182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	3	245	9.8e-98	0.8101694915254237

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	2.77e-122	4	242	58	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02283	MltB_2	1.77e-112	4	246	59	300	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	1.99e-99	4	252	97	343	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02282	MltB	1.68e-53	4	244	53	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK10760	PRK10760	1.31e-39	19	245	135	354	murein hydrolase B; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFK62358.1	4.12e-161	3	319	92	408
AHG64372.1	3.90e-159	3	319	92	408
QPT39908.1	2.39e-153	2	320	87	405
AVL71228.1	7.55e-153	2	320	94	412
QQT87058.1	1.89e-147	3	319	102	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AO8_A	5.43e-95	4	308	104	407	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]
5ANZ_A	2.17e-94	4	308	104	407	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5O8X_A	1.36e-37	4	244	61	299	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	2.00e-37	4	244	78	316	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	4.44e-30	4	244	81	314	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	5.00e-29	4	244	122	355	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002358_01182.