CAZyme Information: MGYG000002357_03295

Basic Information

• Species: Bacillus licheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus licheniformis
• CAZyme ID: MGYG000002357_03295
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43539.32	8.9447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002357	4208157	Isolate	South Korea	Asia

• Gene Location: Start: 3156358; End: 3157491 Strand: -

Full Sequence      

MTKILIFPFLSISTGHHHVADSLQTELLLKSHHCEKIDIFSHAYRRLEKASSAAYLSWIQ
YFPKVYSSVYHLLACGRHETAKRHLLYELIFLKGMQQIIAEKKPDIVFCTHALPSYLLNR
LKGQFPDMKVANVYTDFFVNRIWGREKIDYHFAPIKDIKDQLIAEGVDEEKIFLTGIPVH
RSYKTERKPEQDGDKKAFCNILITGGSMGVGGIFKLVRELSPNGNVAYQILCGKNRKLYR
YVRDLNNPYIKALPYIESKTEMNRLYAEASGIITKPGGVTISECIEKQLPVFIYHALPGQ
EEMNLDILKKKNLVIELNQQKQQPIEQQLLSFFRSDEDIRRYQMSVDQYLREKSDRDFSD
ILDGIIHNRSGLGNAHV

Enzyme Prediction     

No EC number prediction in MGYG000002357_03295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	201	347	2.6e-21	0.9426751592356688

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	1.77e-49	9	318	3	317	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	6.86e-49	4	366	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13609	PRK13609	1.23e-32	3	318	6	323	diacylglycerol glucosyltransferase; Provisional
pfam06925	MGDG_synth	1.14e-25	16	179	1	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.
PRK13608	PRK13608	5.42e-25	3	311	7	316	diacylglycerol glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APJ28210.1	2.31e-281	1	377	1	377
ASV16640.1	2.31e-281	1	377	1	377
AAU24758.1	2.31e-281	1	377	1	377
QNH44127.1	2.31e-281	1	377	1	377
QNT99456.1	2.31e-281	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OT5_A	3.25e-06	92	220	103	251	2.2Angstrom Resolution Crystal Structure of putative UDP-N-acetylglucosamine 2-epimerase from Listeria monocytogenes [Listeria monocytogenes EGD-e],3OT5_B 2.2 Angstrom Resolution Crystal Structure of putative UDP-N-acetylglucosamine 2-epimerase from Listeria monocytogenes [Listeria monocytogenes EGD-e],3OT5_C 2.2 Angstrom Resolution Crystal Structure of putative UDP-N-acetylglucosamine 2-epimerase from Listeria monocytogenes [Listeria monocytogenes EGD-e],3OT5_D 2.2 Angstrom Resolution Crystal Structure of putative UDP-N-acetylglucosamine 2-epimerase from Listeria monocytogenes [Listeria monocytogenes EGD-e]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0SPB9	8.76e-161	1	366	1	364	Uncharacterized glycosyltransferase YkoN OS=Bacillus subtilis (strain 168) OX=224308 GN=ykoN PE=3 SV=1
B7IW03	1.89e-30	93	315	94	320	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain G9842) OX=405531 GN=ugtP PE=3 SV=1
Q81IA1	6.89e-30	93	315	94	320	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=ugtP PE=3 SV=1
B7H9Q4	6.89e-30	93	315	94	320	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain B4264) OX=405532 GN=ugtP PE=3 SV=1
C1EWE6	3.45e-29	93	315	94	320	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain 03BB102) OX=572264 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.542455	0.455388	0.000911	0.000440	0.000329	0.000463

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002357_03295.