CAZyme Information: MGYG000002349_01360

Basic Information

• Species: Streptococcus agalactiae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus agalactiae
• CAZyme ID: MGYG000002349_01360
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		34388.3	4.1826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002349	2041264	Isolate	United States	North America

• Gene Location: Start: 186747; End: 187676 Strand: -

Full Sequence      

MKLKITVICSVVFSLFFFLLLFLVIFFADDTDSGENNKDSSISQGGVTVSPEVLAHRPLI
EKYGKEYGIEDYVSYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSE
LLTSAEQQGVDIDSVIQSYNYGGGFLNYVRSHGKKYTYELAEQFSKEKSGGQKADYPNPI
AIPVNGGWRYNYGNQFYVQLVSQYLTDTSPTEFDDETVQVIMDEALKYEGFPYVFGGASP
TTSFDCSGLIQWVYDKAGISLPRVAQDQYDATQEISMEEAQAGDPIGYGDLSSRYWQDHL
IGARRVIHN

Enzyme Prediction     

No EC number prediction in MGYG000002349_01360.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	6.12e-75	50	205	1	165	Lysozyme-like.
cd16891	CwlT-like	7.28e-75	56	205	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	5.62e-19	230	305	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	2.59e-17	217	308	74	169	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK13914	PRK13914	5.43e-15	209	284	357	431	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDI66079.1	2.02e-218	1	309	1	309
AMD32290.1	2.02e-218	1	309	1	309
AYZ22475.1	1.61e-211	1	309	1	340
APT18759.1	1.61e-211	1	309	1	340
AKI46274.1	1.61e-211	1	309	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	1.78e-196	29	309	2	313	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	2.52e-115	32	306	3	306	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
6B8C_A	1.10e-09	221	308	31	118	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
3PBI_A	4.09e-09	216	289	83	168	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3I86_A	6.02e-09	216	295	10	101	Crystalstructure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis],3I86_B Crystal structure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	1.01e-63	31	306	29	328	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	5.47e-26	56	227	55	220	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P0DC90	8.84e-21	53	197	30	181	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	8.84e-21	53	197	30	181	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	1.71e-20	53	197	30	181	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.863043	0.134462	0.001248	0.000317	0.000194	0.000759

TMHMM  Annotations     

start	end
5	27