CAZyme Information: MGYG000002348_01728

Basic Information

• Species: Lactobacillus crispatus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus crispatus
• CAZyme ID: MGYG000002348_01728
• CAZy Family: GT101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		22808.06	6.7107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002348	1829425	Isolate	Ireland	Europe

• Gene Location: Start: 8352; End: 8942 Strand: -

Full Sequence      

MSNDYNIKVLNKETTLQILLEDHNSLIRFGDGELDLIRGASIPYQDYQPELAGSLKELLL
EGSNRCLLVGLSDVFEKLDRYNDYCRNFYQNSFFPNNHDLLREVELQYNVYVSTFFSRPY
IDLVDKSHAKDYFAKMKQLWQDRDLLIVEGKYSRSGEGNDLFSNARSISRLICPPTNAYS
PKKLLKMKLLKMQLIG

Enzyme Prediction     

No EC number prediction in MGYG000002348_01728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT101	27	191	4.8e-53	0.7276785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03728	glyco_access_1	1.09e-75	9	180	1	171	glycosyltransferase, SP_1767 family. Members of this protein family are putative glycosyltransferases. Some members are found close to genes for the accessory secretory (SecA2) system, and are suggested by Partial Phylogenetic Profiling to correlate with SecA2 systems. Glycosylation, therefore, may occur in the cytosol prior to secretion.
pfam08759	GT-D	6.62e-67	27	180	1	152	Glycosyltransferase GT-D fold. This domain is found at the C-terminus of proteins such as the probable glycosyltransferase Gly that also contain the glycosyl transferase domain at the N-terminus. It is also found N-terminal in numerous putative glycosyltransferases such as GalT1. GalT1 has been shown to catalyze the third step of Fap1 glycosylation. This domain is structurally distinct from all known GT folds of glycosyltransferases and contains a metal binding site. This new glycosyltransferase fold has been named GT-D.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLL73264.1	5.57e-128	1	191	1	191
AZR14904.1	4.26e-116	1	196	1	196
QGS05529.1	4.26e-116	1	196	1	196
QWS35852.1	4.26e-116	1	196	1	196
QYA52121.1	4.26e-116	1	196	1	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5V4A_A	1.54e-52	7	186	6	184	ANew Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36],5V4A_B A New Glycosyltransferase (DUF1792) from Streptococcus sanguinis [Streptococcus sanguinis SK36]
4PFX_A	2.14e-50	7	179	12	182	Thehighly conserved domain of unknown function 1792 has a distinct glycosyltransferase fold [Streptococcus parasanguinis FW213]
4PHR_A	2.14e-50	7	179	12	182	Domainof unknown function 1792 (DUF1792) with manganese [Streptococcus parasanguinis FW213]
4PHS_A	1.20e-49	7	179	12	182	Selenomethioninesubstituted structure of domain of unknown function 1792 (DUF1792) [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU2	8.97e-51	7	186	415	592	Probable glycosyl transferase Gly OS=Streptococcus gordonii OX=1302 GN=gly PE=3 SV=2
A0A0H2URB1	9.04e-40	7	180	548	719	Glycosyltransferase GlyD OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002348_01728.