CAZyme Information: MGYG000002341_02693

Basic Information

• Species: Acinetobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter ursingii
• CAZyme ID: MGYG000002341_02693
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000002341_19|CGC1	41431.86	9.9436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002341	3456217	Isolate	United States	North America

• Gene Location: Start: 27638; End: 28750 Strand: -

Full Sequence      

MHSSSTTGSRLGLNSLFPSIPFRALALSTALIPFHSINAGKTHQYNDVVNSSTLTVVAVE
SPTTVFKEGQFLHGFGYDLTRQYAKSLNVKLNFKTVKDNATALNMVAQGKANFAMTTATF
KTVENKHLISFSASCGDDANLAKNGLNTQLNWVFKYADDPLSQTASGFICQSKQNGITGQ
LASFYNRNVVTPESWPTIKRDLDNRLPIYKASFKKTAEKYDLDWQLLAAIGYQESYLKPN
SVSPTGVRGLMMLTNNTARAMGVTDRVDPAQSIQGGAKYYDLMLSQYQDIPYPDRNWYAL
VAYNMGPGAVSQIQKRLQNQGKNPNNWVVFYDYLNRNKASNGRYRQAVQYVTRIRAYVEH
IKTSERWIDV

Enzyme Prediction     

No EC number prediction in MGYG000002341_02693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	221	364	8.6e-25	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.30e-64	213	363	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	5.54e-64	9	357	2	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.04e-56	79	361	147	431	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	2.74e-22	213	323	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.07e-19	226	357	3	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF78153.1	7.96e-274	1	370	1	370
QQT85293.1	7.96e-274	1	370	1	370
QQT67218.1	7.96e-274	1	370	1	370
CAG69560.1	3.15e-216	1	370	1	370
APV34642.1	4.26e-214	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	9.29e-42	158	328	206	379	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.06e-41	158	328	213	386	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.06e-41	158	328	213	386	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_A	1.95e-41	158	328	199	372	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_B	1.95e-41	158	328	199	372	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	3.72e-43	90	365	171	454	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
Q02RN8	5.39e-42	150	328	229	410	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A4VP14	1.91e-41	103	359	187	449	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mltF PE=3 SV=2
A1U3J1	4.70e-41	148	359	222	446	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
Q9HXN1	1.45e-40	158	328	238	411	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.595086	0.403306	0.000803	0.000449	0.000176	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002341_02693.