CAZyme Information: MGYG000002341_01846

Basic Information

• Species: Acinetobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter ursingii
• CAZyme ID: MGYG000002341_01846
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1080	MGYG000002341_8|CGC1	116566.63	9.7562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002341	3456217	Isolate	United States	North America

• Gene Location: Start: 129165; End: 132407 Strand: +

Full Sequence      

MYKPTNMVWQFPAASLFKITILASALAALGLTTGCSSTPQTAKTNTTKQVGGSGYLDASS
LDSLEDLLSATDMRAVEGDRLQILKHGDVWKRMTVGFKMDLNHWDPRIEAQRSWFISRQP
YLDRLSARASRYLYHTVKEAERRGIPTELALLPVIESSYDPAATSSAAAAGLWQFIPSTG
RIYGLKQTSQYDGRRDVVESTRAAYEFLGSLYNQFGSWELALAAYNAGPGRIQQAINRNQ
AAGLPTDYWSLKLPQETMNYVPRFLAVAQIIKNPKAYNVNLPPIANRPHFREVMLNAPVD
LNQIASLTGLSRAELYALNPGYRGERIDPESPMRILIPSDVNPSVDAKLKALKSSSGFWA
SNNTAATPNANVTVNTSTRGSTQTVTPSRATPPVMTASSISRPSTSSTVVSSITRPLKTT
PRSADELAAFAASADIPSAPRIPVAVTPASNVKALSAEPPISKSEREQIVALVKQEGVKE
TVTQALEPQPTQAEKDQVVAELKAIAPKGTEIVDPYDGKIRLTAIQTSQSVADTEGKEVT
KGFAYPKAVAATVNADSYEAQNNKDKPYIKTDTDIVVVQPSGKRSTYTVQPGDTLAIIAA
KNGVSWRDIAKWNQIDPNNTLFVGATLYLYDAKPQAIDRPVPVKAESKPESYTVKANDSL
TGVADQFGLTVKQLADYNNLSVTSGLFVGQKLSLKDNGTTHNAGSNRNTEAKSDAKTTRV
ATKSYTVKRGEYLKLIADRYALSNQELADLTSGLTASSSLYVGQKINVPLHEVTVRDDDK
ADPKETRNSKLANQVKTENYQVQRGDTLSSIAAKSKMTLAELASLNNIAANSGVRVGQTL
KIPAGSSIPEQYTVQSGDSLNSVANKFDLELSDLAELNGLSRSAGLRVGQKLKLTGDIPA
SAKVEVQETSPDTHIVKSGETLASIASRYHLQLNYLAALNGLSRNANVRVGQKLKLEGDL
PKTETAKDDSPKSKSKGKTAANTESYTVKSGESLNSIASRLGMSAKDLADLNNLNARASL
QRGQSLQIPKTITEYTIKRGDTLIGLASKFGMAITELADLNDLKQNAQLRIGDVIKVPNL

Enzyme Prediction     

No EC number prediction in MGYG000002341_01846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	138	278	1.2e-24	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	2.47e-78	33	385	14	348	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	4.04e-57	141	269	2	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.75e-22	138	243	3	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	2.94e-22	647	894	328	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	6.59e-22	691	957	306	592	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT65368.1	0.0	1	1034	1	1034
BBF79255.1	0.0	1	1034	1	1034
QQT85241.1	0.0	1	1034	1	1034
AVI35991.1	0.0	1	1029	1	1020
AVI34649.1	0.0	1	1029	1	1020

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.05e-12	800	966	44	226	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
6FBT_A	2.41e-07	69	270	378	591	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	2.48e-07	69	270	407	620	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	5.49e-07	69	270	379	592	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	5.49e-07	69	270	378	591	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.12e-61	79	338	49	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.12e-61	79	338	49	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	1.93e-27	126	302	19	192	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P37710	2.65e-25	581	956	357	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
O07532	5.90e-19	643	958	20	352	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000777	0.012523	0.986647	0.000066	0.000017	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002341_01846.