CAZyme Information: MGYG000002341_00815

Basic Information

• Species: Acinetobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter ursingii
• CAZyme ID: MGYG000002341_00815
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1219		132574.01	5.0872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002341	3456217	Isolate	United States	North America

• Gene Location: Start: 60553; End: 64212 Strand: +

Full Sequence      

MATASLGRLTLDLVARTASFSEPLSKAERQARNSGKGIAESMDVASIAVKGLSLAVGGLS
VAGMVAYSEKVINAGNDIQRFSKLANASVSQFQYYAKGAETAGISLESFADKMKDMQDRI
GDFQQTNGGPLADFFTNIAPRIGVTIQQFQKLSGPEALQLFYNSLEKAGASTNDMKFYME
QIISDSSLLIPLLEKNGQGFKFWGDAAKNAGAIMSDDMVKSLAEAKVNLQLLDLQWQGLQ
ATLINDAIPVIEAIAENWDKVEAGATALATVVGVRLAAAFGIAGAQAAASLIQYTRYQVA
LARMAGETITLTTVTRGLGGAMLSLVGGPLGLIALGVQVAIAGGTYYAMTRKTEDATDAF
DMQGKSISELVDHYNSLSQAKQRAFAYDAAKDLEADTEAYEAAKNQVASYASGLAETVLK
QGESADKIRAWRREFIQGAITAEDLANRIGSLSDVTDVYNANMVKYSSAATSAKAKLDAQ
KSVVSSLKVATDEANNSQREQTKLVNESAGAWEKLTQKQREYITQLRKDASRDLYIKSLV
GRGMGVDKANALADAQSSANGENAFKVGLPQSVVDATMKNFNLKNYSFNKSELAAIAKVQ
GIAKANNFAQIEGLYGLPVGTLAALVLQESGGNPNAVSPTGAKGLFQTTSIFRREYGLNA
NSSIEAQATAAAKDLAKKRAKFGTQDYALMAYNAGSDGLNSYLNGGLSSDKRKEVAGYVP
GFQKWFAGVNGKTAVDNSILMPTQADILAQQTLAAQAQKDLSDKRKEIDAQYYTESEKLA
KEHQDRIEKITQAYTGTRELKTRLAQESALYQEQSTQIRVQREEDYANLTAFETDRVKQL
EDYYARQIELAKTSTKINEQERAKEISGLQRKRDFEIAAVRREQDEQVQSAFEAYLNETE
IVVKRYQREREEILANGELLDENRKKLLQAKDMDIFKTMNQASDNVMQFGQYSVQSMLQR
NYPNEYVKWNLQNQYSTDLGGLNDAYSNQVSSINLIDDEDQKNAQLLAAHEQYLKAKSEL
TTDYNQKEIELNTQLYSSNLSAMSSVFGSMGDLIKGYAEESSDAYIAMVAIQKSANLASV
IMNGYTAISAAWASAPFPYNLPAVGMATAQTGVLQAALQAFTPSITGMAHNGIDNIPKEG
TWLLDGGERVLNPQQNQDLTRYLNERQESNSSPVTNVQPITNVINVLDPSLVGDYLATPA
GEKLVLNVIKRNKTVLGNR

Enzyme Prediction     

No EC number prediction in MGYG000002341_00815.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.29e-13	615	722	4	124	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.62e-12	615	695	8	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13399	Slt35-like	8.56e-11	615	698	1	97	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
cd13403	MLTF-like	1.24e-09	622	695	15	95	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	2.37e-09	622	720	4	104	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ64242.1	0.0	1	1171	1	1202
ATD20986.1	0.0	1	1175	1	1176
AXG84740.1	0.0	1	1175	1	1176
AIL80570.1	0.0	1	1175	1	1176
AVI31832.1	0.0	1	1190	1	1188

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P85501	7.01e-08	1040	1177	724	868	Tape measure protein OS=Pseudomonas phage PAJU2 OX=504346 GN=18 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999764	0.000239	0.000001	0.000001	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002341_00815.