CAZyme Information: MGYG000002340_02858

Basic Information

• Species: Intestinimonas butyriciproducens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Intestinimonas; Intestinimonas butyriciproducens
• CAZyme ID: MGYG000002340_02858
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332	MGYG000002340_1|CGC16	38712.65	8.3584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002340	3376471	Isolate	not provided	not provided

• Gene Location: Start: 2997839; End: 2998837 Strand: -

Full Sequence      

MAGLTQKIYRTLRKVKCDLRRDVSCFTPALAVAHALCDLPLRGPVFQPVGRWAAKRRDAA
IFDYLDQNYGAFFETFARQWTPPEKKECSVPVPIWVCWLQGEEQAPKLVRRCIASIRKNA
NGHPVNLLTEENIGRYLSIPRGILQKYRHGAIGQAHFADIARMMLLKEYGGLWLDATILC
TKPVPDWYFQRSFFSCKGPVREGGYISRYRWTSFVLGGMPEAYFYSLMTAFYLEYWKREN
AAIDYLFMDYIIDAAYKRFPILRDEIDKLPENNLRRDDLAACMNEPFIQEKWDALMASDT
VLFKLSWRENYAEQTPTGEPTFYQYFLTEEKA

Enzyme Prediction     

No EC number prediction in MGYG000002340_02858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	108	188	1.9e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05704	Caps_synth	1.15e-91	55	326	15	278	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam04488	Gly_transf_sug	0.010	155	194	54	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP95384.1	1.96e-257	1	332	1	332
QIA33138.1	1.27e-59	48	323	56	328
AKP76105.1	1.31e-55	78	314	54	294
AHF13527.1	4.09e-55	92	327	78	310
QXT30818.1	1.59e-54	22	327	29	335

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002340_02858.