CAZyme Information: MGYG000002339_02140

Basic Information

• Species: Lacticaseibacillus saniviri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus saniviri
• CAZyme ID: MGYG000002339_02140
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40228.24	4.6141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002339	2435520	Isolate	not provided	not provided

• Gene Location: Start: 33046; End: 34104 Strand: +

Full Sequence      

MKKWITQMNQGFSFDATSKAKVDVSTIAMRHDYLPLDLFRYDDNGESDESQIARIDGITA
GVNPGDLIVHQYPSLNSYRFENHFIDQMHLRGISVIIFIHDVDTWRFPYIRDQFDEMAYF
NKADGLIVHGQPMAERLHEEGVTAPMVDHLLLDYLDDEHQWDKYEIKPETFERKLVMAGN
LFKSQFLVHWDLDTPITTFGVTDDELADYLNANSKVTYGGGLFQWDLIEKMPRAFGLAWD
NNLDGRPYGDYTHYNHPHKVSLYLSHGMPVIISKASAVAPFIEANHLGFTINDIHEADAI
VQEIPDDTLAETLAQTARIGRLLREGWFTANALLQAERQLLMSDFNDGGLAL

Enzyme Prediction     

No EC number prediction in MGYG000002339_02140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	14	337	2.9e-83	0.9720496894409938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	3.86e-86	1	340	1	333	sugar transferase.
COG0438	RfaB	1.82e-04	78	318	106	354	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMS15368.1	1.26e-128	1	345	1	345
QFR62055.1	1.26e-128	1	345	1	345
QMU08517.1	6.30e-124	1	345	1	345
QFR24169.1	7.29e-122	1	346	1	346
QEU47078.1	2.08e-121	1	346	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	2.08e-34	1	341	3	330	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.39e-34	1	341	11	338	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	4.11e-34	1	336	3	325	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU1	1.49e-37	1	341	1	333	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	5.99e-35	11	336	10	328	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	2.55e-34	11	336	15	333	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B5A7L9	1.09e-33	1	341	1	328	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	2.16e-33	1	336	1	323	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002339_02140.