CAZyme Information: MGYG000002339_02034

Basic Information

• Species: Lacticaseibacillus saniviri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus saniviri
• CAZyme ID: MGYG000002339_02034
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		33870.99	9.8475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002339	2435520	Isolate	not provided	not provided

• Gene Location: Start: 29372; End: 30292 Strand: +

Full Sequence      

MTNPTVFFAAIKAGALKSWSRGVLPSVTAAQAAIESAWGSSQLALPPNNNLFGIKGTYNG
QSVWFPTQEWSAAAGYYTINDAFRKYPDWSTSVLDHASFFVDNSRYHNLLGVKDYRTFAR
LVQSDGYATAPNYAATIISTIEANGLAAWDQEAFNGVTGVVESWPHKAIDESVAQVVYQP
GYGVNTYYDNGQWTGRRLAHGTRWKVQGRRVIKGQTMLLVGKINGGNEYLPIKYTNIDDA
VLTVNYKEGWGVNVYDGNGKYWGRRLKTGTQWKNNGTKTINGKPMYLVGNSTYLPKQYTQ
FGPGKP

Enzyme Prediction     

No EC number prediction in MGYG000002339_02034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	21	146	7.6e-31	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.48e-48	7	151	46	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.90e-22	3	142	7	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	4.14e-22	7	150	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	4.43e-20	22	96	12	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK08581	PRK08581	6.78e-19	26	152	343	474	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO10138.1	8.10e-95	3	305	58	353
QMU87070.1	2.55e-92	2	306	69	363
AYG25981.1	2.55e-92	2	306	69	363
BAX66310.1	2.55e-92	2	306	69	363
AYG29638.1	2.55e-92	2	306	69	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.05e-18	25	150	52	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.11e-12	23	152	80	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	6.38e-12	20	146	18	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.59e-12	20	146	19	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.42e-18	23	151	68	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	2.56e-15	2	158	59	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.79e-14	2	158	59	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P37710	2.93e-14	26	159	203	342	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P0C2T5	1.24e-13	20	158	79	222	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002339_02034.