CAZyme Information: MGYG000002338_01478

Basic Information

• Species: Staphylococcus haemolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus
• CAZyme ID: MGYG000002338_01478
• CAZy Family: CBM50
• CAZyme Description: N-acetylmuramoyl-L-alanine amidase sle1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36018.78	10.1584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002338	2548117	Isolate	Russia	Europe

• Gene Location: Start: 3962; End: 4951 Strand: +

Full Sequence      

MNKKILATAVLGTGALSTLFAHQAEASTTHTVRSGESLWSISHHYGITVSKLKSLNGLSS
NLIFPNQVLKVSGSSNYSSRSNYGNSSSTYTVRAGDSLSSIASRYGTTYRHIMNLNGLNS
FLIFPGQQLKVSGSVSSNSHSSYNSNSGGSSSTYTVRYGDSLSSIASRYGTTYQHIMRLN
GLNNFFIYPGQKLRVSGSASSNTYSTRSAQSTYYSSPVFNHRNLYDWGQCTWHVFNRRAA
IGKGISTYWWNANNWDNAAARDGYRIDGNPTVGSIAQSDAGYYGHVAFVERVNSNGSILV
SEMNFSASPGILTYRTIPAYQVRNYKFIH

Enzyme Prediction     

No EC number prediction in MGYG000002338_01478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	154	196	2.2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	7.75e-33	196	329	39	171	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK06347	PRK06347	5.30e-29	27	221	330	550	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.36e-25	29	195	407	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	1.21e-20	46	193	282	444	membrane-bound lytic murein transglycosylase D; Provisional
PRK08581	PRK08581	1.53e-19	158	319	438	607	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMW22520.1	2.73e-217	1	329	1	329
QFR06023.1	2.73e-217	1	329	1	329
BAE05856.1	2.73e-217	1	329	1	329
AUV70765.1	2.73e-217	1	329	1	329
QQQ82742.1	2.73e-217	1	329	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K3A_A	3.98e-31	223	329	50	153	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	2.63e-29	216	329	2	112	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]
5T1Q_A	3.73e-17	225	328	248	356	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
4UZ2_A	5.65e-10	89	131	4	46	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	3.88e-08	89	131	4	46	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L3C1	5.45e-218	1	329	1	329	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q5HRU2	3.74e-145	1	329	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	3.74e-145	1	329	1	324	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q6GJK9	1.52e-144	1	329	1	334	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sle1 PE=3 SV=1
Q2YVT4	1.28e-143	1	329	1	335	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.998949	0.000195	0.000201	0.000186	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002338_01478.