CAZyme Information: MGYG000002338_01367

Basic Information

• Species: Staphylococcus haemolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus haemolyticus
• CAZyme ID: MGYG000002338_01367
• CAZy Family: GH23
• CAZyme Description: putative transglycosylase SceD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		24616.03	3.9441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002338	2548117	Isolate	Russia	Europe

• Gene Location: Start: 4251; End: 4958 Strand: -

Full Sequence      

MKKTIIASSLAVGLGVVAGNAGHADASEAQVNKAELAQLAQSNDQSLNDSPIQEGAYNVT
FDYEGFTYHFESDGTNWSWNYAQSGQASQQQDVSAQASTVSNQTSAEQVGSQQQSSQAQP
TQTQQAPQTEQTQQPQTEATTSNSSSSNNNASSGSSVNVNSHLQQIAQRESGGDITAINP
SSGAAGKYQFLQSTWDSVAPDEYKGVSPAQAPEDVQDAAAVKLYNTAGASQWVTA

Enzyme Prediction     

No EC number prediction in MGYG000002338_01367.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06737	Transglycosylas	1.18e-20	162	235	4	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	3.90e-18	166	234	6	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
cd00736	lambda_lys-like	3.55e-04	182	229	51	94	Bacteriophage lambda lysozyme and similar proteins. Lysozyme from bacteriophage lambda hydrolyzes the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. However, unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan, but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli, though they differ structurally.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJI70515.1	1.04e-126	1	235	1	235
AMW23878.1	1.04e-126	1	235	1	235
AKC75696.1	1.04e-126	1	235	1	235
BAE04248.1	1.04e-126	1	235	1	235
QFR07441.1	1.04e-126	1	235	1	235

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L7X7	2.08e-127	1	235	1	235	Probable transglycosylase SceD OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sceD PE=3 SV=1
Q5HEA4	1.98e-84	1	235	1	231	Probable transglycosylase SceD OS=Staphylococcus aureus (strain COL) OX=93062 GN=sceD PE=1 SV=1
Q2YUK8	3.99e-84	1	235	1	231	Probable transglycosylase SceD OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sceD PE=3 SV=1
Q6GEX9	5.66e-84	1	235	1	231	Probable transglycosylase SceD OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=sceD PE=3 SV=1
Q2FWF8	1.14e-83	1	235	1	231	Probable transglycosylase SceD OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sceD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000579	0.998417	0.000258	0.000265	0.000226	0.000208

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002338_01367.