CAZyme Information: MGYG000002330_00229

Basic Information

• Species: Eisenbergiella tayi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella tayi
• CAZyme ID: MGYG000002330_00229
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000002330_6|CGC1	39599.56	4.8263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002330	7416064	Isolate	not provided	not provided

• Gene Location: Start: 14041; End: 15093 Strand: +

Full Sequence      

MENYLKSPLWNNRLPVEERLDYLIGEMTTEEKIACLTTGCPDISRLGIRASYMGGEAAHG
IEARHDQAFNKGEPEPTTSFTQPIGMSASFDRELIRECGRCVGEEARALFTRNGSGGLCR
WAPTVDMERDPRWGRTEEAYGEDPYLTGEMASSYIQGMKGDDPFYIRCGATLKHFYANNV
EKDRISISSSLDRRNKYEYYLEPFRKAIVEGGAEAVMTSYNEINGIPAIVNEEVRTILKE
AWGLPGHVVCDGGDMQQTVYDHKYFKTHEETVAYGLKAGVDCFTDDKSVVMEAARKALEK
GMITEEDIDRSIRNSFRTRIRLGFFDGDGECLIREWERSMSIIRNTGIFV

Enzyme Prediction     

EC	3.2.1.120	3.2.1.74

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	43	282	1.6e-58	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	1.35e-64	8	330	41	374	Probable beta-xylosidase; Provisional
COG1472	BglX	3.60e-55	43	326	55	319	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	7.19e-40	23	325	41	359	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.70e-39	44	313	62	311	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL12929.1	2.50e-196	7	331	11	335
CBL10090.1	2.50e-196	7	331	11	335
VCV20176.1	2.50e-196	7	331	11	335
ABX43682.1	9.62e-171	3	330	5	332
BCN30880.1	1.50e-148	2	339	463	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC6_A	2.10e-39	19	326	25	340	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC7_A	2.10e-39	19	326	25	340	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
6Q7I_A	3.25e-35	7	328	40	364	GH3exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7I_B GH3 exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7J_A Chain A, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4],6Q7J_B Chain B, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4]
5TF0_A	5.21e-31	42	326	70	342	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	7.31e-31	44	326	119	387	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LXD6	8.67e-57	11	328	51	373	Beta-D-xylosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BXL3 PE=1 SV=1
Q94KD8	5.75e-56	14	328	49	365	Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=BXL2 PE=2 SV=1
Q9SGZ5	1.00e-53	14	328	43	367	Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BXL7 PE=2 SV=2
Q9FGY1	2.65e-52	14	328	54	371	Beta-D-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BXL1 PE=1 SV=1
Q9FLG1	3.98e-52	11	328	61	383	Beta-D-xylosidase 4 OS=Arabidopsis thaliana OX=3702 GN=BXL4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002330_00229.