CAZyme Information: MGYG000002329_00965

Basic Information

• Species: Dielma sp001305055
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma sp001305055
• CAZyme ID: MGYG000002329_00965
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462	MGYG000002329_9|CGC1	52957.17	5.0902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002329	3357599	Isolate	not provided	not provided

• Gene Location: Start: 8817; End: 10205 Strand: +

Full Sequence      

MIKYPCMWGTAISAGQCEGGCHKGNKGYSIGDTQPNERERCFKRYPLPDEHAYYAMQKGV
EFYEHYEEDIQLLKELGVQCFRMSIAWSRIFPHGDDEEPNEEGLAFYDRIFDLLVQNGIE
PIVTLSHLEIPYALFEKYDGWENKHWIAAYTRYADTCFSRYSDRVHLWITFNEINMALYL
PLSVGVGVDRSEHQEECCWQAVHNMLAANAKAIQLAKAVNARNEVGAMIAYSPIYPMTCR
PEDVLKADEIRSNALTIADVLVHGAYSDTALNRFEKAGIDLKMSEEEQTLLSEQRVDFLA
TSYYNSIVASSEDAAVKASGNLFGGVKNPYLTESEWGWTIDPIGIRICLKELYDRYKLPL
MIVENGLGAKDEIIDGQIHDEYRIAYLREHINEVLKAIDEGIHLKAYTMWSFLDLVSASS
GEMKKRYGLVYVDLDNEGKGTLKRIPKDSFKWYQKFLKKQHI

Enzyme Prediction     

No EC number prediction in MGYG000002329_00965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	460	2e-137	0.972027972027972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	8	455	10	448	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	2.61e-163	7	458	9	470	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	2.87e-159	7	455	9	464	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.30e-154	7	455	11	468	6-phospho-beta-glucosidase; Reviewed
pfam00232	Glyco_hydro_1	3.21e-144	7	459	10	450	Glycosyl hydrolase family 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST58194.1	2.78e-153	3	457	7	477
AGB18325.1	2.78e-153	3	457	7	477
BBF41877.1	5.30e-153	7	458	8	466
QAA30917.1	4.43e-152	2	457	3	465
QHZ45037.1	7.53e-152	7	454	13	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.63e-151	3	457	7	462	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.44e-136	1	457	4	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	9.76e-136	1	457	4	473	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	3.17e-133	7	457	25	478	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3PN8_A	5.07e-133	7	457	12	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.96e-146	7	457	13	462	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	4.82e-142	7	457	12	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	4.54e-136	7	454	9	469	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	1.62e-132	7	457	9	466	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	1.89e-131	7	457	9	455	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000012	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002329_00965.