CAZyme Information: MGYG000002325_01126

Basic Information

• Species: Listeria monocytogenes_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria monocytogenes_B
• CAZyme ID: MGYG000002325_01126
• CAZy Family: GH73
• CAZyme Description: Internalin B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000002325_1|CGC23	28351.33	10.7522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002325	3017944	Isolate	Canada	North America

• Gene Location: Start: 1134910; End: 1135668 Strand: +

Full Sequence      

MDKRAFVYYPKATNVKTLNLTGKITAGSTNGLWSEVPGTVNAKKLATTAGAYQNKDAKVI
KQGQISGRTYYQFQVNGKTIGWLDARAFHIYDKIQSQSNVNWNRTILNADKHGVYSGVYN
TSSSSMNKLSTGAKYNNKKVKVIKQAKTARGTWYQFQVNGKTVGWMDYRAFFDTITSQKT
MNKTVTVGNATNHGVFDGVYRTSPKVKRISLGKPYNNKKVKVLKEAVTDHATWVQFKYGN
TTAWMDKKAFKY

Enzyme Prediction     

No EC number prediction in MGYG000002325_01126.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033202	GW_glycos_SH3	4.95e-22	92	171	1	78	GW domain. The GW domain of Listeria belongs to the clan of SH3-like domains. A similar but broader model (PF13457) occurs in Pfam. The GW domain occurs as repeats on surface proteins of the cell-invading pathogenic bacterium Listeria monocytogenes, and is involved in binding to glycosaminoglycans. Members of this family include the GW-type internalin InlB and several paralogs.
NF033202	GW_glycos_SH3	6.56e-20	11	91	2	81	GW domain. The GW domain of Listeria belongs to the clan of SH3-like domains. A similar but broader model (PF13457) occurs in Pfam. The GW domain occurs as repeats on surface proteins of the cell-invading pathogenic bacterium Listeria monocytogenes, and is involved in binding to glycosaminoglycans. Members of this family include the GW-type internalin InlB and several paralogs.
pfam13457	SH3_8	2.90e-17	97	172	1	74	SH3-like domain.
NF033202	GW_glycos_SH3	4.95e-16	173	251	1	79	GW domain. The GW domain of Listeria belongs to the clan of SH3-like domains. A similar but broader model (PF13457) occurs in Pfam. The GW domain occurs as repeats on surface proteins of the cell-invading pathogenic bacterium Listeria monocytogenes, and is involved in binding to glycosaminoglycans. Members of this family include the GW-type internalin InlB and several paralogs.
pfam13457	SH3_8	2.19e-14	16	88	2	73	SH3-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY48666.1	1.85e-179	1	252	321	572
QOF65656.1	1.85e-179	1	252	321	572
APO61250.1	1.85e-179	1	252	321	572
AMD27034.1	1.85e-179	1	252	321	572
AMD24113.1	1.85e-179	1	252	321	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JQC_A	2.69e-117	2	171	90	259	Crystalstructure putative autolysin from Listeria monocytogenes [Listeria monocytogenes EGD-e]
1M9S_A	1.51e-17	2	241	348	583	Crystalstructure of Internalin B (InlB), a Listeria monocytogenes virulence protein containing SH3-like domains. [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DQD3	8.39e-17	2	241	381	616	Internalin B OS=Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) OX=1334565 GN=inlB PE=1 SV=1
O33983	2.32e-16	9	249	596	834	Protein Ami OS=Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) OX=1334565 GN=ami PE=3 SV=1
P0DQD2	3.80e-16	2	241	381	616	Internalin B OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlB PE=1 SV=1
O32083	6.48e-07	14	90	203	278	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002325_01126.