CAZyme Information: MGYG000002324_01547

Basic Information

• Species: Ligilactobacillus salivarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus salivarius
• CAZyme ID: MGYG000002324_01547
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000002324_1|CGC17	40382.69	9.0278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002324	1978364	Isolate	China	Asia

• Gene Location: Start: 1538772; End: 1539815 Strand: -

Full Sequence      

MKKYIVSIYDDSEYNAGPKAKKDIEDILVEDNFEKISLKFKLNNSLRSKILKIKYKYIDI
PLSLSKIEKNSIVFLQYPAYSSFILKIIIKKLKEKSKKLFYIVHDVESLRLFRDKPEYHH
EERSLLNMADGLIVHNQEMRKWLIKDGITVPMVDIKVFDYLNDKIDRQSTSFDKSICFAG
NLSKSSFLEEVETKYELDLYGMYPAKEYKNGVKYKGAYPPSELGKQLTQNFGLIWDGDSV
EECNGIYGEYMQYNNPHKFSLYLSLGIPVIIWEKAALAKFVKKNNVGITIANLKDLDRIL
DNITYEEYKEMKKNSEEIGNSVRQGKFTKTAVEEIIRKVDNLGDITK

Enzyme Prediction     

No EC number prediction in MGYG000002324_01547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	10	336	4.3e-114	0.984472049689441

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	9.18e-105	1	339	1	333	sugar transferase.
cd03794	GT4_WbuB-like	1.33e-06	122	336	157	390	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP35569.1	2.78e-251	1	347	1	347
ARU18698.1	1.54e-248	1	347	1	347
QLL72389.1	7.32e-247	1	347	1	347
AKI05008.1	1.02e-175	106	347	1	242
QFS34615.1	7.65e-114	1	334	1	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	2.40e-13	1	336	3	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	2.52e-13	1	336	11	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	6.79e-48	4	336	2	324	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	3.86e-21	64	336	59	330	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	5.15e-21	89	339	85	332	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
F8KEJ1	5.14e-14	64	339	64	337	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B3XPQ7	1.21e-13	64	336	59	329	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002324_01547.