CAZyme Information: MGYG000002322_02589

Basic Information

• Species: Escherichia marmotae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia marmotae
• CAZyme ID: MGYG000002322_02589
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000002322_33|CGC3	75531	9.178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002322	4486744	Isolate	not provided	not provided

• Gene Location: Start: 175167; End: 177194 Strand: +

Full Sequence      

MIGIFSSGIWRIPHLEKFLAQPCQKLSLLRPVPQEVDAIAVWGHRPSAAKPVAIAKAAGK
PVIRLEDGFVRSLDLGVNGAPPLSLVVDDCGIYYDASKPSALEKLVQDKAGNAALADQAR
EAMHTIVTDDLSKYNLAPAFVADESEHSDIVLVVDQTFNDMSVTYGNAGQNEFAAMLEAA
IAENPQATIWVKVHPDVLEGKKTGYFADLRATQRVRLIAENVSPQSLLRHVSRVYVVTSQ
YGFEALLAGKPVTCFGQPWYAGWGLTDDRHPQSALLSARRGSATLEELFAAAYLRYCRYI
DPQTGAVSDLFTVLQWLQLQRRHLQQRNGYLWAPGLTLWKSAILKPFLRTATNRLSFSRR
SPAATACVVWGVKGEQQWRAEAQRKSLPLWRMEDGFLRSSGLGSDLLPPLSLVLDKRGIY
YDTTRPSDLEVLLNHSQLTLAQQMRAEKLRQRLVESKLSKYNLGADFSLPDEAKGKKVIL
VPGQVEDDASIKTGTVSIKSNLELLRTVRERNPHAYIIYKPHPDVLVGNRKGDIPAELAA
ELADYQALDADIIQCIQRADEVHTMTSLSGFEALLHGKHVHCYGLPFYAGWGLTVDEHRC
PRRERKLTLADLLYQALIVYPTYIHPTRLQPIAVEEAAEYLIQTPRKPMFITRKKAGRVI
RYYRKLIMFCKVRFG

Enzyme Prediction     

No EC number prediction in MGYG000002322_02589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	280	649	3.4e-148	0.706766917293233
GT107	9	321	4.2e-111	0.5902255639097744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	4	648	6	646	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16439	beta_Kdo_transferase_KpsC_2	2.01e-163	368	623	4	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	5.59e-153	367	623	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16440	beta_Kdo_transferase_KpsC_1	8.67e-150	39	302	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	2.03e-144	39	299	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLP28382.1	0.0	1	675	1	675
VEF97979.1	0.0	1	675	1	675
QLX31674.1	0.0	1	675	1	675
AMX34939.1	0.0	1	675	1	675
AWO23737.1	0.0	1	675	1	675

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	2.50e-242	2	352	3	353	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	2.64e-75	2	317	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	3.90e-71	337	642	10	319	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	0.0	1	675	1	675	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	1.08e-202	6	643	28	673	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	1.52e-202	6	643	28	673	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	3.59e-56	335	623	80	381	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002322_02589.