CAZyme Information: MGYG000002319_01988

Basic Information

• Species: Limosilactobacillus mucosae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus mucosae
• CAZyme ID: MGYG000002319_01988
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000002319_12|CGC5	68478.53	6.0405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002319	2369669	Isolate	not provided	not provided

• Gene Location: Start: 247996; End: 249771 Strand: +

Full Sequence      

MLYPKMTATRTLTTLDGMWQFQPEKHVQDPAEPLDNPTWVAVPGSFNSQLLDEELNNSVG
YFWYATTFQMPLEQLKRQNFLRFGSVSHQAEVYLNGHLVMKHIGGFTPFEANIDKFLKEG
TNDLKVRVCNILDDTTLPSAKYDRESGKITYRFDFFNFTGIHRPVRLYSTNETYLTSVHV
NYQTDLKQTVVTPQVKINGAYDHCEYVILDQNGKKVVKAKDNEKLLISDTHLWQPNHGYL
YQLVVNVMDEEGELLDTYTKEFGVRTVKVTKNQFLINDKPFYFQGFGKHEDFFASGKGLN
MPLITLDHQILKSLGANSYRTSHYPYSEEQMQQADRDGIVIIDEVPAVGLFVGFNVNVEI
PQKGQTTWNTLKTAANHELAIKEMMERDVDHPAVVMWSLANETAGHEDGAHEYYAPLVKL
ARSLDPQHRPMTWIDIMMDSAEKNQIGDLFDVICLNRYDGWYVAHGDLETAGKMLTAEIK
KWRERYPEKPIMFTEFGADTVPGMHTINHSPYSEEYQTDFYRMYFKVFDQFDYIVGEQLW
AFADFQTSNSMIRIDGNLKGVFTRDRRPKQVVGLLKQRWLHDYDDRCHKVK

Enzyme Prediction     

No EC number prediction in MGYG000002319_01988.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	7	557	3.5e-92	0.5970744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	0.0	1	579	1	592	beta-D-glucuronidase; Provisional
COG3250	LacZ	2.45e-90	9	579	9	595	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	6.47e-75	267	579	1	297	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.64e-31	14	404	75	451	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	2.23e-22	12	170	1	168	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNX32506.1	4.59e-239	1	579	1	583
AYJ44927.1	1.99e-222	1	579	1	583
AVM42696.1	4.16e-200	1	579	1	590
APR07752.1	4.27e-198	1	579	1	593
QOP49798.1	4.27e-198	1	579	1	593

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JKK_A	1.02e-189	1	580	4	589	CrystalStructure of Streptococcus agalactiae beta-glucuronidase in space group I222 [Streptococcus agalactiae 2603V/R],4JKL_A Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R],4JKL_B Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R]
4JKM_A	5.33e-187	1	579	4	592	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
5C70_A	1.62e-161	1	579	9	597	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	2.86e-160	1	579	34	622	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6U7J_A	3.84e-155	1	579	10	590	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	1.28e-149	1	579	1	588	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P06760	5.04e-124	1	579	27	622	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1
O97524	1.15e-119	1	579	27	625	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
Q4FAT7	2.35e-119	1	579	28	626	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
P08236	4.98e-118	1	579	27	626	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999824	0.000195	0.000006	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002319_01988.