CAZyme Information: MGYG000002310_07050

Basic Information

• Species: Microvirga massiliensis
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Beijerinckiaceae; Microvirga; Microvirga massiliensis
• CAZyme ID: MGYG000002310_07050
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		42308.41	9.2618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002310	8892798	Isolate	not provided	not provided

• Gene Location: Start: 170312; End: 171478 Strand: -

Full Sequence      

MAGSISLAVWLYLLICRGHFWLCAEQDDNLAPNCELAGRWPSVIAVVPARNEADGIEQSI
HSLLQQRYPARFTILLVDDQSTDCTAARAEAVASHAGGGDRLTVIRGTDLPPAWTGKVWA
MQQGLAYAGLQADPPDFVLFTDADIVHAPDVLKRLVAAACAREAVLISLMAKLRCESLAE
RISIPAFVFFFQKLFPFAWVNDPARRTAAAAGGCMLVRRDPLLRAGGLAAIRDALIDDCA
LAMLMKGQGPIWLGLTEKIRSHRAYPALGDIRRMVARSAYAQLRYSPLRLAATLAAMALV
YLTPPLTALCTVGAARWVGVAAWALMAFAFQPTLRLYALRPIWSLALPLIAGMYMVFTTD
SALQHWRGRGGAWKGRFQAAESRGAHNR

Enzyme Prediction     

No EC number prediction in MGYG000002310_07050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	222	1e-21	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03469	HpnB	6.56e-158	5	380	7	384	hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms.
pfam00535	Glycos_transf_2	4.20e-19	42	222	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06423	CESA_like	4.61e-19	46	238	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06438	EpsO_like	6.69e-18	46	166	2	113	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd04192	GT_2_like_e	8.98e-18	46	158	2	106	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ02741.1	4.20e-135	3	379	7	377
BCJ91988.1	9.03e-135	5	385	9	390
BAP89644.1	7.48e-134	1	379	8	381
CCB66985.1	8.74e-132	3	383	8	386
AMN40767.1	1.37e-131	3	379	7	385

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.875648	0.122133	0.001528	0.000192	0.000172	0.000320

TMHMM  Annotations     

start	end
293	315
336	358