CAZyme Information: MGYG000002309_02928

Basic Information

• Species: Kurthia senegalensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Kurthia; Kurthia senegalensis
• CAZyme ID: MGYG000002309_02928
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41115.08	8.6346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002309	2976740	Isolate	Senegal	Africa

• Gene Location: Start: 10439; End: 11512 Strand: +

Full Sequence      

MAQWFNSFFQGIILIYMCIVIGVYLIMLIFALVELYRNRDVAREAIDEELQDVDYMYPLS
ILVPAYNESVNIINTVQSLLSSNFPQYEIIIINDGSKDDTLDVAIEQFQMKKIKKVVQRS
LPSKDIRGIYQSKMDPRILLIDKENGGKADSLNCGINLSKYPYFCSIDGDCVLGENSLLQ
VMEAIVQDPNVIAAGGNVKVANGSDIQMGSLMKFNLSARPLVLMQVIEYFRAFLMGRITF
SRFNMIFIISGAFSIFSKKDVVEAGGYLRDTIGEDMELVVRLHRLIRRKDKKKKIKFLPF
PVCWTEVPETFQQLKRQRSRWHQGLMESLWRNKEMLFNPRYGKNAFLTFPYFCSSNV

Enzyme Prediction     

No EC number prediction in MGYG000002309_02928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	60	258	1.4e-21	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	4.74e-62	61	275	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	1.18e-43	8	354	15	308	N-glycosyltransferase; Provisional
COG1215	BcsA	3.04e-41	1	349	2	310	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK14583	hmsR	3.96e-30	59	355	77	329	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd00761	Glyco_tranf_GTA_type	4.16e-23	61	197	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAB05950.1	4.24e-134	16	352	23	363
QEY20998.1	1.81e-133	8	352	13	358
QGM31506.1	1.81e-133	8	352	13	358
QKS72985.1	3.52e-133	1	352	1	353
AUS88144.1	5.15e-133	8	352	10	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.73e-08	59	215	7	125	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
7SP7_A	8.66e-07	89	330	117	352	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	3.55e-06	89	330	117	352	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6P61_A	6.03e-06	59	190	15	122	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GDD8	6.30e-29	52	332	42	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q99QX3	6.30e-29	52	332	42	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q5HCN1	6.30e-29	52	332	42	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q7A351	6.30e-29	52	332	42	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q9RQP9	6.30e-29	52	332	42	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000007	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
12	34