CAZyme Information: MGYG000002306_01528

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_01528
• CAZy Family: GT1
• CAZyme Description: putative glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000002306_132|CGC1	40536.94	4.7984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 2893; End: 4065 Strand: -

Full Sequence      

MKIVLAAYGSRGDVEPCAAVARELQGRGHDVRIALSPDQLGLAESAGLRAVAYGPDSREQ
IDTATDFVHTVQNPISALPQLTERVTAVWAAKSETLAALAAGADLLVAGMNEQRLAANVA
QRVGAPLAALHFFPADTLELGWMQSHVTAAAEAAQRLALGLPVDAGQSDRAALEIQAYDE
LCVPGLAEQWATAGHRRPFVGSLTLGLASGVDDEVLSWIADGTAPVYFGFGSTPVSSPAE
TVAVISAACARVGERALICSGPNDFTGIPPEDHVKIVPAVNHAAVFPACRAVVHHGGSGT
TAAGLRAGVPMLILWLWLDQPVWAEAVSALEVGLARAFSASTLDSLTADLRCVLDGRYHD
RAREVATRMTKPGESVAAAADLLEEAARGG

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	5	387	3.1e-35	0.9685863874345549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	6.82e-64	1	372	2	384	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	1.85e-43	1	369	1	388	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	1.05e-05	261	373	266	377	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	3.47e-05	3	48	1	48	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
pfam00201	UDPGT	4.99e-05	226	356	278	408	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ76318.1	1.76e-278	1	390	1	390
AZP81577.1	1.76e-278	1	390	1	390
AZA71528.1	1.76e-278	1	390	1	390
AJK79610.1	1.76e-278	1	390	1	390
AJK75443.1	1.76e-278	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3H4I_A	8.18e-32	1	378	1	374	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.48e-28	1	378	1	391	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1PN3_A	1.24e-22	1	365	1	367	CrystalStructure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]
1RRV_A	4.51e-20	1	383	1	395	X-raycrystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
5XVM_A	4.48e-10	222	343	268	398	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN07	2.68e-141	1	388	1	411	Uncharacterized glycosyltransferase Rv1524 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1524 PE=1 SV=1
P64866	2.68e-141	1	388	1	411	Uncharacterized glycosyltransferase Mb1551 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1551 PE=3 SV=1
P9WN06	2.68e-141	1	388	1	411	Uncharacterized glycosyltransferase MT1575 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1575 PE=3 SV=1
Q49929	4.45e-134	1	387	1	409	Uncharacterized glycosyltransferase ML2348 OS=Mycobacterium leprae (strain TN) OX=272631 GN=ML2348 PE=3 SV=1
P64870	4.48e-117	1	388	1	413	Uncharacterized protein Mb1553c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1553C PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002306_01528.