CAZyme Information: MGYG000002306_00569

Basic Information

• Species: Mycobacterium avium
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium avium
• CAZyme ID: MGYG000002306_00569
• CAZy Family: GT85
• CAZyme Description: Galactan 5-O-arabinofuranosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		39257.71	10.4032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002306	4669710	Isolate	Australia	Oceania

• Gene Location: Start: 130; End: 1203 Strand: +

Full Sequence      

MALWLAGLRWRRHGIRAALEPLRRLAVIVGIAVAIGCTTWLPFLVRAARNPVSNTGSAQH
YLPADGAELTFPMLQFTLLGVVCMAGTLWLVLRARASVRAGALAIGVLAVYLWSLLSMLT
TLARTTLLSFRLQPTLSVLLVAAGAFGLVEAALALRRRSRAVIPVAGAIGLAAAIAFSQD
IPDVLRPDLTIAYTDTDGHGQRGDRRPPSAEKFYASIDDVITRETGRPRDQTVVMTADYS
FLSFYPYWGFQGLTSHYANPLAQFDLRAAQIDKWSKLKTADELLHALDTCPWPPPTVFLM
RHGANNTYTLRLAEDVYPNQPNVRRYTVELRAALFDSPRFAVHRVGPFVLAVRKPAA

Enzyme Prediction     

No EC number prediction in MGYG000002306_00569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT85	1	175	3.7e-61	0.405152224824356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12249	AftA_C	2.88e-111	181	353	1	177	Arabinofuranosyltransferase A C terminal. This domain family is found in bacteria, and is typically between 179 and 190 amino acids in length. This family is the C terminal region of AftA. The enzyme catalyzes the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. The C terminal region is predicted to be directed towards the periplasm.
pfam12250	AftA_N	1.26e-53	1	158	252	406	Arabinofuranosyltransferase N terminal. This domain family is found in bacteria, and is typically between 430 and 441 amino acids in length. This family is the N terminal region of AftA. The enzyme catalyzes the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. The N terminal region has been predicted to span 11 transmembrane regions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZA68857.1	6.34e-250	1	357	327	683
AYJ04066.1	7.83e-250	1	357	323	679
QGW30505.1	7.83e-250	1	357	323	679
ANR91770.1	7.83e-250	1	357	323	679
AXO25245.1	8.69e-250	1	357	326	682

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN02	3.07e-188	1	355	286	639	Galactan 5-O-arabinofuranosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=aftA PE=3 SV=1
P9WN03	3.07e-188	1	355	286	639	Galactan 5-O-arabinofuranosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aftA PE=1 SV=1
Q7TVN5	3.07e-188	1	355	286	639	Galactan 5-O-arabinofuranosyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=aftA PE=3 SV=1
Q9CDA6	9.95e-187	1	355	274	628	Galactan 5-O-arabinofuranosyltransferase OS=Mycobacterium leprae (strain TN) OX=272631 GN=aftA PE=3 SV=1
A0R611	1.19e-152	11	355	271	615	Galactan 5-O-arabinofuranosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=aftA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.894952	0.025272	0.075288	0.000206	0.000173	0.004112

TMHMM  Annotations     

start	end
21	43
71	93
100	122
132	154
161	178