CAZyme Information: MGYG000002305_01710

Basic Information

• Species: Leminorella grimontii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leminorella; Leminorella grimontii
• CAZyme ID: MGYG000002305_01710
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		42839.01	6.934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002305	4219592	Isolate	not provided	not provided

• Gene Location: Start: 396094; End: 397248 Strand: -

Full Sequence      

MSNRPLTIGLVAGETSGDILGAGLIRALKERVPDARFVGVAGPLMQAEGCEAWFEMEELA
VMGVVEVLERLPRLLKIRQTLVQRFSELKPDVFVGIDAPDFNITLEGKLKQSGIKTIHYV
SPSVWAWRQNRVFKIGRSTNLVLAFLPFEKAFYDRFNVPCRFIGHTMADAMPLDADVEAA
RQRLGIASDVHCLALLPGSRHAEVEMLSADFLQTARLLRERYPDLEILVPLVNAKRRQQF
EQIKATVAPDLSVRLLDGQARDAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFTFW
LAKRLIKTPYVSLPNLLAGRELVKELLQEECTPQKLYDALMPLLDKQNENVKALRETFTE
LHQSIRCDADVQAAEAVLELAGRQ

Enzyme Prediction     

No EC number prediction in MGYG000002305_01710.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	366	1.5e-141	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	380	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	5	383	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	5	384	1	378	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.47e-179	8	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	9.66e-53	10	360	231	591	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI36376.1	1.10e-261	1	383	1	383
QBH95657.1	1.75e-236	1	382	1	382
AWH89503.1	1.44e-235	1	382	1	382
AKJ43035.1	5.52e-231	1	382	1	382
VEJ56371.1	5.52e-231	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.42e-214	4	381	5	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.98e-213	4	381	5	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6DAJ6	5.00e-223	1	380	1	379	Lipid-A-disaccharide synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=lpxB PE=3 SV=1
B5RHG7	5.61e-222	2	381	3	381	Lipid-A-disaccharide synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=lpxB PE=3 SV=1
B5FJ29	5.61e-222	2	381	3	381	Lipid-A-disaccharide synthase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=lpxB PE=3 SV=1
B5R421	5.61e-222	2	381	3	381	Lipid-A-disaccharide synthase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=lpxB PE=3 SV=1
Q57T26	5.61e-222	2	381	3	381	Lipid-A-disaccharide synthase OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002305_01710.