CAZyme Information: MGYG000002301_01734

Basic Information

• Species: Staphylococcus warneri
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Staphylococcaceae; Staphylococcus; Staphylococcus warneri
• CAZyme ID: MGYG000002301_01734
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase-stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	MGYG000002301_4|CGC1	52060.25	5.5199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002301	2673052	Isolate	China	Asia

• Gene Location: Start: 11777; End: 13117 Strand: +

Full Sequence      

MINLFEYYNQPTQLLHQTLEQADYHNFTICIEDDGFLPDEVTSPYQFFAANLLHDDDQPK
FFNAVDVPPFWEISGDGQSAQIKDMGHIRGEIRYRPHYKTRIVSHVRWFDDKGRLRSEDH
YSKHGFKFAETIYDLAGKAILKKYVTREGKEVIYENYVTGDYVLDWQGQSYFFPSKVAFI
TFYLQQIQVDLSEIIINSLSTPFLVLHHMNTEGKGLLFWQESSNGHVPGNMLSLLDGTLQ
RQFSVMIPDYREYHTVVAQLNSEQASHVYQAGYLYDFDKSNQYSNHALILTNSDEIPQLE
HIIVAHPNMQFHIAALTEMSSKLMTYDQHQHVHLYPAATKDIFAELYQLCDIYLDINQGN
EIENAVARAFHHQHVILAWDEVAHQRPFTAPENTFTLEQLNQFNQVLHDITTNHQQFDLH
RTYQARHANQLTIDTFVSIIQQALYE

Enzyme Prediction     

No EC number prediction in MGYG000002301_01734.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	0.0	1	440	1	438	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC89464.1	0.0	1	446	1	446
QDW95458.1	0.0	1	446	1	446
QKI07812.1	0.0	1	446	1	446
QJX54951.1	0.0	1	446	1	446
QAV30723.1	0.0	1	446	1	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9U_B	4.06e-96	2	444	2	445	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5E9T_B	4.18e-96	2	444	2	445	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q79T00	1.60e-99	1	444	1	445	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1
Q3S2Y1	1.97e-95	1	400	1	402	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
A0A0H2UR90	4.80e-94	1	444	1	443	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
A1C3M0	1.41e-81	1	395	1	393	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1
A0A0S4NND9	9.43e-72	1	404	1	399	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002301_01734.