CAZyme Information: MGYG000002295_01360

Basic Information

• Species: Ruminococcus_C callidus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C callidus
• CAZyme ID: MGYG000002295_01360
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
934		104587.76	4.6084

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002295	2957494	Isolate	China	Asia

• Gene Location: Start: 105314; End: 108118 Strand: +

Full Sequence      

MFRSYDLSGVWDFSMAQMAKGTFPTAFSDTISLPNTTSLAKKGTPNPRRETGFLTDAYAF
EGQAWFRKKIYIDPELIDPDIGCCPMKLTLERTRMTTLWIDGRRVGSCDSLCTPHVYDIT
AYVTKPLVEILVLVENTGYPTKGGHLTSPDTQSNWNGITGQMTLEVFPEVYADHVQAYPN
PAEKNVTLTMQLHGASTASFTATGSVMEDDEEDSIPLFQAQLTADENGTASVTIPLDEAY
YAWSEYHPAMYYLVYNIDEADCGYVSFGMREFCADGSRFTINGQPTMLRGKHDGLIFPKT
GYAPTDVNEWLRVLGIAKSYGINHYRFHTCCPPDAAFTAADLLGIYMEPELPFWGTIAAP
GEEGYNEAEQNYLIALGDKMLETFGNHPSFVMFSLGNELWGSPERLGEILRHYKEKDSRH
LYTQGCNNFQHFPLMVPEDDYFVGVRLSKERLLRGSFGMCDAPLGHVQTDRPSTMHQYDD
VIFPRQTAGEDSGDTEEIEIQYGTGVKKVQVSKTAGGLIPTKPVITHEIGQYEVYPDFRE
IEKYTGPLKARNFEVFRERLAARGMLHQANRFFRCSGALAAACYKEEIEAAMRSRYIAGF
QLLDLQDFSGQGTALVGMLDAFLDNKGLISPEEWRMFCSDCVLLAQFPSYVLITGEMFAA
KVSLRTVLPQSGKAEWLLIRENGDKLGEGRFSVQAESGLTEIGSIFCRMPEELQQPERVH
LILSLADTDVCNVYDLMLYPAIAMPALEDQGELCVTEQLETALAALAAGKKTVFFPRETA
ESIQGFYCTDFWCYPMFRDICNWMKKPVAVGTMGLCIQDDHPALELFPTQEYSTPQWYDI
VTAADCTILDDTPAGFTPIVQMIDNFERNHKLGILWEAKVGSGSLLVCTSRLSEIATRPE
VRWLAKSLLHYAASEAFAPQQSVTAEQLRKWFGV

Enzyme Prediction     

No EC number prediction in MGYG000002295_01360.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	443	3.3e-54	0.48404255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.08e-13	98	537	114	539	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	4.60e-06	276	417	5	153	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16908.1	0.0	1	932	1	930
BAV13119.1	0.0	1	928	1	929
ADL53165.1	0.0	1	928	1	929
QKS45132.1	0.0	1	933	1	943
AOZ93913.1	0.0	1	930	1	931

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.10e-07	65	482	123	525	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.11e-07	65	482	124	526	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3GM8_A	1.17e-06	11	425	13	424	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
6D1P_A	4.59e-06	243	398	276	428	Apostructure of Bacteroides uniformis beta-glucuronidase 3 [Bacteroides uniformis str. 3978 T3 ii],6D1P_B Apo structure of Bacteroides uniformis beta-glucuronidase 3 [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O07684	1.16e-09	7	421	45	490	Beta-galactosidase large subunit OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=lacL PE=3 SV=2
T2KPJ7	4.76e-08	98	404	135	436	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O52847	4.55e-07	7	421	61	503	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	6.05e-07	65	482	124	526	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q02603	1.46e-06	7	425	44	493	Beta-galactosidase large subunit OS=Leuconostoc lactis OX=1246 GN=lacL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002295_01360.