CAZyme Information: MGYG000002292_02655

Basic Information

• Species: TF01-11 sp003529475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp003529475
• CAZyme ID: MGYG000002292_02655
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		32067.57	5.2785

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002292	3137432	Isolate	China	Asia

• Gene Location: Start: 13167; End: 13985 Strand: -

Full Sequence      

MGAVALLVILMFIMGCFFIKDDKVKTLEKNDYGVFLNADASSLERFKRYDLIVIDAQYFT
KKDIESLHQNGTKVYTYLNIGSVENFREYYKTYEKFTIGKYEHWDEEKWVDVSVPAWQKF
IEQLSKKLFEKGVDGFFIDNCDVYYYAPRKSIFEGLTAILQNIMTLKKAVIINGGDTYVT
EYRERYGAVDHIMTGVNQESVWSGIDFDKGTFNEQTRETREYYSKYLEACKADGMEVYLL
EYTTDEKLIQKIKKYCKEKNFHFYISNSLELQ

Enzyme Prediction     

No EC number prediction in MGYG000002292_02655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	50	268	1.2e-61	0.9866071428571429

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3868	COG3868	2.31e-23	47	269	78	301	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	9.52e-18	50	267	18	216	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	9.59e-16	6	245	1	254	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	5.78e-04	64	157	64	168	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06591	GH31_xylosidase_XylS	0.002	50	159	41	173	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	2.34e-106	28	271	39	282
VCV23723.1	2.34e-106	28	271	39	282
CBL11057.1	2.34e-106	28	271	39	282
AOZ95737.1	4.38e-90	28	272	41	286
QHI71547.1	1.70e-86	6	271	6	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000025	0.000050	0.999965	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
2	19