CAZyme Information: MGYG000002291_01494

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_01494
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		31785.32	7.3712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 296; End: 1126 Strand: -

Full Sequence      

MQSLAILLTVFNRKAKTLQCLQNLYAQLPIEGYTVDVYLTDDGCTDGTPEAVKEQFPDVN
ILHADGNLFWNRGMYRAWSRAAETNDYDFYMWLNDDTTIYPDALSVLLQTSNAYKDKCII
VGKTCAVGNQAIITYGGRTEKKGLMHPSDKTQQCDFFNGNIVLFPKSVLEKVGMNDYRFR
HALGDFDYGMRARKLGVQSVVAPGILGECDEHDSLPVWCNPKKPFNKRWKAFRSPLGHNP
EEFFIYENRHHGIVMACFHYFTNHLRVMCPWIWRKD

Enzyme Prediction     

No EC number prediction in MGYG000002291_01494.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	230	9.1e-17	0.9478260869565217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	4.17e-31	1	275	2	282	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	3.61e-19	6	204	1	159	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04185	GT_2_like_b	6.01e-14	5	196	1	160	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.84e-10	6	158	2	148	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	7.48e-09	10	212	6	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH80634.1	9.71e-126	1	274	1	273
QVY66624.1	3.29e-116	2	273	4	276
AOE12622.1	1.09e-115	1	274	1	274
QUU03358.1	9.18e-115	1	275	1	273
QCQ55754.1	2.62e-114	1	275	1	273

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_01494.