CAZyme Information: MGYG000002291_00633

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_00633
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000002291_2|CGC5	69150.14	5.6471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 336420; End: 338288 Strand: +

Full Sequence      

MKYRLSTFISMLLVAFSVVTAGEVWVSPSGNDGNAGTKDAPLRTVAQALKRAREWRRLSN
PAVQGGVRVLLQEGVYRQEKALLVRPEDSGTAESPTIVEAAEGAKVIISGGKLLTGWKRV
TEDIPGLPAVAKGKVWRADAPLVGNRLAEFRQLWVNGVKAVRSTQFAPREMQRMLAFDKD
KEEIWISTPAIEGLDEARGMEMTVHQRWAIAILRIKEFDIQGERTRVTFHQPESELEFAH
PWPQPVIDGEKGSSSFCLGNALRLLDTPGEWYQDYPSGQVYYWPREGEDMLRAEVVAPVV
EKLITVDGSLERPVSHITFKGIDFQHAGWYRPSLEGHVTLQGGMYLLDAYKLPIPGLPEK
AELENQAWIARPEAAVTVRGANHIDFRNCAFRHLGATGLDYEWAVTDSEVKGCLFTDIGG
TALALGAFPDGGFETHIPYIPVNKKELCSGISITNNLITEVTNEDWGCVGIGAGYVRDVT
IEHNEVSHVNYSGICVGWGWTPLNSGMKNNRIHANYVHHFARQLYDAGGLYTLSNQPGSS
MTENRLEHLADAPYATNDRAFYIYFDEATDGYRVENNWCPEARFDSNRPGPVNVWTNNGP
MVSEEIKSAAGLLPEYGYLRNK

Enzyme Prediction     

No EC number prediction in MGYG000002291_00633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	581	5e-209	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	8.16e-09	375	535	25	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.65e-06	403	599	6	149	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	0.001	369	544	37	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam07602	DUF1565	0.004	29	76	2	38	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77842.1	0.0	1	621	1	621
ALK85163.1	9.17e-306	1	611	46	654
AII69040.1	3.71e-305	1	611	1	609
QUT84057.1	3.71e-305	1	611	1	609
AII63063.1	7.48e-305	1	611	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.63e-201	18	620	21	623	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000355	0.998918	0.000193	0.000164	0.000170	0.000160

TMHMM  Annotations     

start	end
5	27