CAZyme Information: MGYG000002290_02943

Basic Information

• Species: Sellimonas sp002161525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Sellimonas; Sellimonas sp002161525
• CAZyme ID: MGYG000002290_02943
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
980		109905.24	4.7502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002290	3837069	Isolate	China	Asia

• Gene Location: Start: 14126; End: 17068 Strand: +

Full Sequence      

MTDETRRTDGAGETVEREERMAQDIPEAASGIEWDEQEDREEQEKRKEREAKTRKRKKPG
RGRKGPKWKRWLRRILTVLAVLLVLSGIGYLIVTHTSFYKELQETAYDTLATMDKGTFRK
LGNTKILDGKGNVIGEVDSGSYEYREISDIPLDLQNAYIAAEDQNFKTHHGVDYKATLRA
ALALVKNGGEITQGGSTITQQVIKNNLLSQEQSFLRKFLEILMAPELEKKYSKQEIMEFY
CNSNYYGNGCYGVGSAARFYFGKDVTELTTAECAMLAGVSNSPNNYNPVASMELATKKKN
SILNKMQECGFLTEEECKKAKEQEITVTQTETSLLSSSNYMCSYAMHCAALKLMEQDGFE
FRYLFDSEEDYEQYDAAYTDSYKKMASLIRGGGYTIQTSFDTGIQEKLQASVDQSLSGSK
ETQENGKYALQGAAVCIDNETGYIVAMVGGRGEDQFNRAFLSERQPGSTIKPLLVYGPAF
DRGIAVPSSIYTDKKVTVSGYSPKNANNRYLGAMNLRKALALSTNTVAFQVFREVGQENA
LKYLEQMKFSSIRYADNSAMSIALGGFTYGVKVDEMARAYAAIQNHGSYRNQTCLVKITH
ETEGTVYDGKEKPVQVYSEDAAFMLTDTMEGVLEESYGTGANIDLKGQIAAGKTGTTNSN
RDVWFCGYTNYYTASVWVGRDDNGVLSRTDYANRIWESFMNQVHQGKAASDFQVPDTIEY
RNVLSGGKLGSRKAGNLDMGKRSYLRRPAGYDLYSSQNAKKLKKHQEEKELKEALENAEA
KVAAFEAYEITSVATAKGMDSAYASAVEAVEAIPDPEKQPSFKTRVAEKYEKLQKTYQEW
ETKIEEADAEAAKQAAAERDAKDEANQAAATEKLHKQRVSNMEWYLDALADRDYNTDTAR
RLLQDAANALENCREYDEYNFLKQRYEEQASRIQGLPTEVPTPEVPENRYDTIEDDYPDD
EVPEADSSASDEPDSTEEQE

Enzyme Prediction     

No EC number prediction in MGYG000002290_02943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	131	307	9.2e-61	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	2.68e-173	123	712	55	605	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.24e-166	143	706	3	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.45e-138	124	718	49	733	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	8.30e-84	134	733	136	710	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	8.16e-78	126	738	39	593	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP41393.1	4.77e-210	101	721	62	684
ASN93939.1	4.77e-210	101	721	62	684
QIX92626.1	4.77e-210	101	721	62	684
QJU21747.1	9.50e-210	101	721	62	684
QQQ98855.1	2.67e-209	101	721	62	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	6.58e-65	125	718	22	737	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	2.22e-62	125	718	9	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3UDF_A	2.97e-62	146	710	43	722	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3ZG8_B	4.23e-59	226	681	2	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
2OLU_A	8.03e-59	125	718	18	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	6.67e-89	123	681	55	598	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
P38050	1.09e-79	123	719	48	611	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
A7FY32	5.30e-79	126	723	59	663	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A5I6G4	5.30e-79	126	723	59	663	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
P39793	1.10e-78	112	726	65	664	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
71	93