CAZyme Information: MGYG000002289_00008

Basic Information

• Species: Coprococcus sp000433075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus sp000433075
• CAZyme ID: MGYG000002289_00008
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000002289_1|CGC1	39758	4.9581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002289	2644240	Isolate	China	Asia

• Gene Location: Start: 6958; End: 7989 Strand: +

Full Sequence      

MKTLYGFKKGINLGGWLSQGSLEKEHLDTFITEKDIIKIASWGLDHVRLPIDYDNFENED
GSDKENGYFYIDSCIKWCRKHGLNVVLDLHKTYGYVFDKPAESINFFYDEALQKRFYKIW
EKLITRYAKDSDIIMFEPLNEVVSPDVINEWNDISSNCINIIRSKAPNAKILLGGVCYNA
VTTIKHLPHTDDENIVYNFHCYEPMLFTHQSAYWVDGMPEDFHIEYPGDWNKYVTESKKI
PGCINGAFADESLGLHTLGPEFFEAMFLDGIKAVEERNGFMYCGEYGVIDRAPLNGTLNW
YKDIHSVFEKYGIGRAAWNYKEKDYGLQGEHYAPIINELVRYL

Enzyme Prediction     

EC	3.2.1.-	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	325	3.8e-137	0.9968051118210862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.97e-22	7	324	51	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	6.68e-19	30	216	23	209	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82603.1	1.88e-215	1	343	1	343
BCN29487.1	6.52e-123	1	343	1	338
ADU22290.1	7.22e-123	1	343	1	341
EGC02962.1	2.22e-119	1	343	1	341
ADD61786.1	3.49e-118	1	343	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	5.17e-83	4	343	1	338	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.46e-82	4	343	1	338	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
5BYW_A	2.39e-20	10	319	88	359	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_C Chain C, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_D Chain D, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],5BYW_E Chain E, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
3AMC_A	3.41e-18	9	320	14	288	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AOF_A	1.61e-17	9	320	14	288	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16169	5.04e-84	6	315	6	288	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
A3DJ77	4.01e-82	4	343	1	338	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	4.01e-82	4	343	1	338	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	1.28e-80	4	343	1	338	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P25472	3.04e-20	10	319	38	298	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002289_00008.