CAZyme Information: MGYG000002284_01917

Basic Information

• Species: Megamonas funiformis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas funiformis
• CAZyme ID: MGYG000002284_01917
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670		79263.53	5.9697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002284	2244659	Isolate	China	Asia

• Gene Location: Start: 8133; End: 10145 Strand: +

Full Sequence      

MEVSALKDFDLYLYHQGTNFYAYQMLGAHFVVEDGVEGVRFAVWAPHAKAISVVGDFNNW
DYNENPMQRISDGEIWVTFIPNLQQGEIYKYSIEPFNGGERFLKADPYAFYAEKKPKTAS
RVYDLRGYEWHDEKWQKKQQQEASYDKPMLIYEVHLGSWRRDAEGNYLTYREAAKQLISY
VKEMNYTHIEFMPLCEHPFDGSWGYQATGYYAVTSRYGEPKDFMYLVDLAHQNGIAVIMD
WVPGHFCNDAHGLRRFDGETLYESDNEKRRENWQWGTTNFDYGRREVHSFLISNALFWLN
EYHIDGLRIDAVANMLYLNYGREEGQWEPNKYGDTGNLEAMELIKNLNEAIFKYHPNALM
MAEESTSWPMISRPTYMGGMGFNYKWNMGWMNDMLKYMSLDPIYRKWNHDKITFSLMYAF
SENFVLPLSHDEVVHGKCSLIEKMPGDYWRKFAGLRSFFGYWMTHPGKKLLFMGGEFGQF
IEWKYDDSLDWHLAELYPMHTKMQRFSKELNKFYCEHKALWQVDFDWRGFRWIDCNDNEN
SVISFIRYAEDQDDFIIIVCNFTPEVRHGYRIGVPEKGIYQEVFNTDKEEYGGSNVLNEG
DFKSEDVFWHNLNQSIQITLPPLGTVYFRLKLRPVEAKKQTVIEAEKPEKVKLNGNRSKQ
RQKAKAYALK

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	180	479	1.2e-155	0.9933554817275747
CBM48	26	111	3.9e-20	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	1	633	2	630	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	6	630	6	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	8	628	605	1220	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	24	622	25	613	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	6	631	100	724	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA10858.1	0.0	1	670	1	670
QIB60907.1	0.0	1	670	1	670
SNU93538.1	0.0	1	644	1	644
CBL05409.1	0.0	137	670	3	536
QNH53463.1	0.0	1	631	1	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GQW_A	2.09e-242	6	644	129	785	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	5.94e-242	6	644	129	785	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR0_A	5.94e-242	6	644	129	785	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.19e-241	6	644	129	785	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR2_A	3.39e-241	6	644	129	785	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8CVY1	1.28e-294	8	629	8	626	1,4-alpha-glucan branching enzyme GlgB OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) OX=373903 GN=glgB PE=3 SV=1
Q8DLB8	1.04e-258	6	630	106	750	1,4-alpha-glucan branching enzyme GlgB OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=glgB PE=3 SV=1
C3PCL8	2.89e-258	14	639	14	623	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain A0248) OX=592021 GN=glgB PE=3 SV=1
B9J2G8	2.89e-258	14	639	14	623	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain Q1) OX=361100 GN=glgB PE=3 SV=1
Q81K82	2.89e-258	14	639	14	623	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis OX=1392 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002284_01917.