CAZyme Information: MGYG000002281_01335

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_01335
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000002281_4|CGC5	36330.88	9.1454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 228357; End: 229319 Strand: +

Full Sequence      

MLVPRKIVFFLFLLVGLSLYAQQDYFVSSYVRGNFYNRGRIAAESLRASDDLIFLNVRPH
KDGSLSFENPRVFQEKGVTTWEELIKSVRADVKGTKAKLRLGAAGGEWKAMVADEAARTT
FAKNIKKVLGENKLDGIDLDFEWAETEKEYKDYSLAILKMREVLGDKYLFSVSLHPVSYK
ISKEAIAAVDFISLQCYGPSPVRFPMEKYASDIQMVLAYGIPKEKLVAGVPFYGVTKNGS
KKTEAYFSFVQDGLITTPAQNEVTYKGEVYVFDGQDHIRTKTRYAMEQQLKGMMSWDLAT
DMPLKDSRSLFRTMLEELGR

Enzyme Prediction     

No EC number prediction in MGYG000002281_01335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	64	307	2.4e-38	0.8040540540540541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	6.12e-27	54	301	30	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	6.85e-27	25	301	5	334	Glyco_18 domain.
cd06548	GH18_chitinase	1.17e-25	25	301	4	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd06545	GH18_3CO4_chitinase	1.22e-15	65	314	28	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
cd02879	GH18_plant_chitinase_class_V	4.71e-15	75	301	50	293	The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes. The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT73150.1	1.61e-207	1	320	1	321
QMW85474.1	7.65e-206	1	320	1	321
QQA08775.1	7.65e-206	1	320	1	321
ALJ39670.1	7.65e-206	1	320	1	321
QUT41003.1	7.65e-206	1	320	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	2.74e-18	52	301	39	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
6TSB_AAA	5.90e-12	27	314	38	346	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	6.34e-12	27	314	57	365	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
4MNJ_A	1.32e-11	80	301	54	333	CrystalStructure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
3WIJ_A	3.20e-11	80	301	54	333	Crystalstructure of a plant class V chitinase mutant from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9W092	3.39e-09	111	301	137	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
C5P230	2.37e-07	25	234	43	294	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
P0CB51	3.16e-07	25	234	43	294	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q1E3R8	3.16e-07	25	234	43	294	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
Q5AM60	6.97e-07	108	319	117	373	Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001339	0.997642	0.000403	0.000193	0.000196	0.000211

TMHMM  Annotations     

start	end
7	26