CAZyme Information: MGYG000002277_01986

Basic Information

• Species: Marvinbryantia sp900066075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia; Marvinbryantia sp900066075
• CAZyme ID: MGYG000002277_01986
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34615.47	4.3321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002277	3435610	Isolate	China	Asia

• Gene Location: Start: 27732; End: 28670 Strand: +

Full Sequence      

MKSHVSLFLLFLLLAVFPAFHADASQSTDADAPASVKSIACPSVNGALHVDGRQLTDEHG
NAVQLKGISTHGLAWFPDYVNQKAFHQLRQEWNVNVIRLAMYTTESGGYCTDGEQGHLKS
LIDQGVSYASSEDMYVIIDWHILSDQDPNQYKEQALAFFAEMSEKYADHNNVLYEICNEP
NGSTTWNDVKSYAEQVIPVIRSNAPDAVILVGTPNWSQYVDQAAADPITDYDNLMYTLHF
YAATHKEDLRNTLQTALDQGLPVFVSEYSICDASGNGALDIGQADAWMQLLDQYQVSCVN
WSLCNKRESAAS

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	59	300	2.7e-98	0.9915611814345991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.50e-76	57	306	2	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	3.18e-11	58	245	56	227	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCV18962.1	9.29e-125	38	311	58	330
SIP56505.1	2.55e-123	22	311	62	349
SIP56560.1	2.55e-123	22	311	62	349
SIP56455.1	2.55e-123	22	311	62	349
ACR74405.1	5.48e-123	22	311	62	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	5.93e-96	45	312	10	273	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZW_A	3.69e-89	45	312	9	275	Endo-glucanasechimera C10 [uncultured bacterium]
4XZB_A	1.23e-87	45	312	9	276	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
1A3H_A	6.37e-87	45	312	6	270	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	7.01e-87	45	312	9	273	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07940	1.17e-97	63	309	19	264	Endoglucanase 4 OS=Ruminococcus albus OX=1264 GN=Eg IV PE=1 SV=1
P22541	2.84e-97	46	311	114	379	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P15704	8.34e-87	40	312	39	308	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P07983	1.90e-85	1	312	1	302	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
O85465	7.50e-85	45	312	35	299	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000193	0.999157	0.000174	0.000160	0.000147	0.000134

TMHMM  Annotations     

start	end
5	22