CAZyme Information: MGYG000002275_01849

Basic Information

• Species: Paraprevotella sp003477995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp003477995
• CAZyme ID: MGYG000002275_01849
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45865	9.6603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002275	3751567	Isolate	China	Asia

• Gene Location: Start: 75346; End: 76545 Strand: -

Full Sequence      

MNQNNRHRAWGQALILGLLATGMTACGEKEQKEELKVSYESIAGNQEITGSYDLPQILES
GELIAVTLSGPDTYYEYREKPTGLQYELAERFATQIGASLRIEVVKDTAELVKRIVDNDA
DLIAVELDVTPFGKVLQACGSYSQNGKEKKKSWAVSKGATELAEALDKWYRPELKKAVQT
EESRKFLPQFLVRRRPRAPFLSRSQGIISPYDAHFKRHASAINWDWRLMAAQCYQESAFD
PNAVSWAGARGLMQIMPSTAQHLNLPMEQIYQPERNIQAAAKYLRELEYKFSDINPREER
LWFVLASYNGGAGHIQDARTLARNAGRNANRWDEVKHFVLNLSDPRFYNSREVKYGYMRG
SETYQYVESIRSRWTEYRRVAKPERMPTKAKGERKKKFR

Enzyme Prediction     

No EC number prediction in MGYG000002275_01849.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	222	372	2.5e-27	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	2.48e-78	215	379	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	2.86e-68	54	371	36	444	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	6.09e-53	53	371	15	425	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	7.53e-27	225	329	11	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	1.43e-26	210	334	5	128	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB48180.1	6.40e-110	6	381	2	368
EFC70077.2	1.66e-107	14	392	6	378
VEH15587.1	3.02e-107	14	381	40	398
ALO48082.1	1.29e-106	23	380	15	366
AGB28026.1	7.35e-106	19	382	34	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OWD_A	3.56e-35	44	384	1	435	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	3.56e-35	44	384	1	435	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	1.16e-34	54	384	4	428	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
5AA2_D	1.17e-34	42	384	33	469	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	1.60e-34	42	384	33	469	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KJ50	1.47e-37	41	371	27	447	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A8GI11	5.81e-35	54	371	36	444	Membrane-bound lytic murein transglycosylase F OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltF PE=3 SV=2
Q02RN8	1.15e-34	42	384	24	459	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=mltF PE=3 SV=2
A6V102	1.60e-34	42	384	24	460	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=mltF PE=3 SV=1
Q9HXN1	1.60e-34	42	384	24	460	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mltF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000058	0.999975	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002275_01849.