CAZyme Information: MGYG000002273_04936

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_04936
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		72972.44	8.5243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 1348; End: 3336 Strand: -

Full Sequence      

MKKLFLSLLIICGCFARFDAQAQRLPAQQSPVSPVEPIMIRQLSGNEQCRQWVDSVLNKM
NLKERIGQLFIYTIAPQQNKANRDLLRKVVDDYKVGGLLFSGGLIENQVALTNEAQKMAD
IPLMITFDGEWGLSMRLRGTPVFPRNMVLGCIQDNELLYEYGREMARQCRELGVQVNFAP
VADVNINPKNPVINTRSFGESPANVADKVIAYSRGLEEGGVLSVSKHFPGHGDTDVDSHH
SLPMLSFSRARLDSVELYPFRKAIQAGLSGMMVGHLEVPVLEPKRGVPSSLSRKVVHDLL
TQEMKFQGLVFTDALAMKGVSTTDQTVCLKALKAGHDLLLVPRRIKEEVDAVLDAVKSGE
LTEAEIEAKCRKVLTYKYALGLSKKPFVRLSGLGNRINTAHTRDLIRRLNQAAIIVLQNK
DNMLPLDAGTPEVAVLNVGDAKEIQPFLKELSGYIKASASGGMHNAVPAVFQLKKELPEA
ARKQLRDSLSQYKRILVCVTDHRLIPYQAFFNEFAPDVPVAYLLFIPGKQVLQIRRGVSA
ADAVILAHSSMDDVQEQVARILYADATADGHLSASIGNLFATGDGLAITPKTPRHFIPDE
HGVNSRLLARIDEIAKEGIKEGAYPGCQIVVLKDGKEMYNKASGHILGEEPSAFQPINFL
SR

Enzyme Prediction     

No EC number prediction in MGYG000002273_04936.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	341	4.8e-56	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	3.40e-81	62	375	2	315	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	3.24e-80	60	436	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	1.83e-31	95	364	26	301	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.05e-27	1	426	1	407	beta-glucosidase BglX.
PRK03642	PRK03642	0.003	598	645	30	76	putative periplasmic esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59284.1	0.0	1	644	1	640
QDO71487.1	0.0	1	644	1	640
QUT89658.1	0.0	1	644	1	640
QRQ48901.1	0.0	1	644	1	632
QUT62072.1	0.0	1	657	1	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.84e-66	60	576	11	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	7.52e-61	54	425	36	446	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.38e-60	54	425	10	420	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.18e-60	54	425	40	450	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	4.05e-55	30	402	7	371	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.12e-60	54	425	36	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.66e-45	86	458	55	456	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	4.32e-36	52	426	18	398	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
A0A0H3M1P5	5.80e-33	63	377	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
L7N6B0	5.80e-33	63	377	62	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000584	0.672897	0.325651	0.000322	0.000288	0.000229

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_04936.