CAZyme Information: MGYG000002273_02984

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_02984
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000002273_19|CGC3	34907.88	8.7382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 93697; End: 94632 Strand: -

Full Sequence      

MKKIIVTILFLGMVLGGNAQNSSSPYQAVVAQDGSGDYTSVQDAVNAAPENRREPWLIFV
KNGSYREQVVVPPTKTYIHLIGQDKNKTIIHHNLNVGGKPEEGIEPSKAAFWKHSVHNPA
SEVHKFEGSVVYVKGNHFYTENISYINDWGVDNQNGPQALAMSSQADCASFNNCILRSFQ
DTWMTSRNDSHRLYVKDCWIEGAVDYFYGSGDALLENCTLYNVRSGSVIVAPSHKNVKSV
MYSVTAQLTVMLRQLTVSRNWDVRGTIHRVRYISILLCASLWHRKVGQIWGLFRLCLLSM
TVGMPKAMCWT

Enzyme Prediction     

No EC number prediction in MGYG000002273_02984.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	243	9e-54	0.6631944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.53e-36	28	247	2	181	Pectinesterase.
PLN02990	PLN02990	2.29e-32	28	220	261	425	Probable pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	3.59e-30	30	236	9	195	pectinesterase
PLN02217	PLN02217	1.85e-29	18	220	242	415	probable pectinesterase/pectinesterase inhibitor
PLN02933	PLN02933	3.78e-29	26	235	218	393	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61310.1	3.83e-153	1	238	1	238
QUT93110.1	3.83e-153	1	238	1	238
QDO69224.1	6.92e-144	1	238	1	238
QGT73190.1	4.32e-115	1	293	1	297
QDM11324.1	8.66e-115	1	238	1	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	9.53e-20	29	227	10	179	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.05e-17	28	226	5	174	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	2.70e-13	22	220	27	217	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.58e-11	23	233	1	211	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
4PMH_A	3.45e-09	38	230	48	254	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	4.67e-26	28	238	258	444	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43043	8.35e-25	20	218	51	220	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q9FJ21	1.59e-23	29	220	261	424	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8GX86	2.09e-22	29	220	257	419	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2
O81301	5.26e-22	29	224	209	375	Probable pectinesterase/pectinesterase inhibitor 40 OS=Arabidopsis thaliana OX=3702 GN=PME40 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001588	0.883574	0.113984	0.000316	0.000274	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_02984.