CAZyme Information: MGYG000002273_02469

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_02469
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000002273_14|CGC2	56991.87	7.9913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 62162; End: 63676 Strand: -

Full Sequence      

MNKLMKFLSLCLLLSFVLPVQAKVDAVMNEPDQVYLFSYSNHDGRSGLKFAWSPDGEKWF
SVADGFAYVNSDFGPWGRAKTMFKPHLMQTRADGKWHCIWAATNTGEALAYVTSPDLQKW
EAQKYFSPAERSKYEPKDVFPTTEKKIVINGHEQEGWMQEVPYATVQSIIRFAEAKKYRQ
SLNAERTEQDPVRFANLKPVEATIRVKADEAKNISNHLIGIFFEDINYAADGGLYAELIQ
NRDFEYAPTDRGNDQNWNSTHSWSVRGENGKLSIATENPIHPNNSHYAVFEVNMPAEVSL
VNSGFDGIAVKKEEKYDFSFFSKMLVGKGGKVKVALQTKDGKEVAMSVLSVTSKEWKKQR
AVLTAYQDATDAVLTITPLVWMGTQQLALDMVSLFPQKTFKGRKNGLRADLAQTLADLHP
RFMRFPGGCVAHGDGVDNIYDWKGSIGPLEARKPLRNLWGYHQTRGLGYHEYFLFCEDMG
AEPVPVVAQVCLARLRYLCPSFQR

Enzyme Prediction     

EC	3.2.1.55

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	1.65e-21	388	487	32	125	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam02018	CBM_4_9	1.79e-07	236	376	1	128	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
cd08979	GH_J	0.004	35	121	79	168	Glycosyl hydrolase families 32 and 68, which form the clan GH-J. This glycosyl hydrolase family clan J (according to carbohydrate-active enzymes database (CAZY)) includes family 32 (GH32) and 68 (GH68). GH32 enzymes include invertase (EC 3.2.1.26) and other other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). The GH68 family consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10, also known as beta-D-fructofuranosyl transferase), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9). GH32 and GH68 family enzymes are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) and catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18607	GH130	0.006	43	151	29	128	Glycoside hydrolase family 130. Members of the glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89981.1	3.46e-301	1	488	1	485
ALJ58903.1	1.98e-300	1	488	1	485
QDO67474.1	9.21e-292	1	488	1	486
AVM53995.1	2.64e-241	1	488	1	486
BBK85669.1	7.02e-235	1	488	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.61e-35	203	487	2	289	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2VRQ_A	5.69e-09	405	483	50	124	StructureOf An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_B Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus],2VRQ_C Structure Of An Inactive Mutant Of Arabinofuranosidase From Thermobacillus Xylanilyticus In Complex With A Pentasaccharide [Thermobacillus xylanilyticus]
2VRK_A	9.35e-08	405	483	50	124	Structureof a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus],2VRK_B Structure of a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus],2VRK_C Structure of a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	9.62e-53	214	487	48	316	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q9SG80	7.35e-34	180	484	26	325	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
U6A629	6.39e-33	220	492	36	301	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
Q8VZR2	8.06e-29	203	484	41	324	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
B8NKA3	5.45e-28	203	484	27	301	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999027	0.000198	0.000167	0.000161	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_02469.