CAZyme Information: MGYG000002273_02468

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_02468
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000002273_14|CGC2	37220.12	4.8264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 61150; End: 62151 Strand: -

Full Sequence      

MGQQGGIPMEEMPQYIQDVLDLIEYANGDARKTVWGKKRAEAGHPKPFNLKYIGIGNEDM
ITEVFVERFKMIFDAVKEKYPEVTVIGTTGPFYEGTDYEVGWDLATELGVPMVDEHYYVE
PGWLIHNQDYYDRYDRKKAKVYLGEYAAHLPGRPNNVETALAEALYLTAVERNGDVVEMT
SYAPLLAKDGHTQWNPDLIYFNNTEVKPTVGYYTQLMYGQNSGNEYLASDVKLNNGWDAV
KKRVGVSVVKDANTGDYIVKLVNMLPVEVSAQVKLDGVALVNPSATKTVLAGDPKDKSAK
PVSSDFKVEGNDFPYAMPAYSFTVIRIHQGVGK

Enzyme Prediction     

No EC number prediction in MGYG000002273_02468.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	15	217	4.2e-58	0.35079365079365077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06964	Alpha-L-AF_C	1.96e-39	144	321	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	1.23e-31	144	321	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
COG3534	AbfA	1.44e-11	16	327	132	498	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58903.1	3.96e-222	1	333	507	839
QUT89981.1	5.61e-222	1	333	507	839
QDO67474.1	8.21e-222	1	333	508	840
BBK85669.1	2.02e-197	2	333	515	846
QUT64858.1	2.02e-197	2	333	515	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.88e-36	5	327	296	624	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	4.85e-59	2	229	324	547	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q9SG80	1.36e-35	15	323	346	651	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	1.41e-33	15	323	345	648	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
Q0CTV2	1.39e-32	10	325	321	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
B8NKA3	1.90e-32	10	328	321	629	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_02468.