CAZyme Information: MGYG000002273_01003

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_01003
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492		53478.57	4.5896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 200411; End: 201889 Strand: +

Full Sequence      

MPEIVIPENILTNGLNFSGTGGTNTLSIKSNVPLEVTSSQTWCTVTPVSSTSSTVLKYTI
DVEPNTGTDERTATISVKGGNLAEQKFNIVQLVGEVDEPDEPGEPAEPGSNEIAGETPWA
VAKSLGLGWNLGNQLDAYSNGIANETIWGNRKTTQALFDKLAAAGITTVRIPVTWMGHIG
AAPGYEIEKAWLDRVAEVVGYAEKAGLNAIVNIHHDGADSSYWLNIKEAAKSESKNTAVK
AELEAIWTQIAERFKDKGNFLAFESMNEIHDGGWGWGENRTDGGKQYAVLNEWNQVFVDA
VRAVGGENADRFLGVPGYCTNPELTISSFKLPTDKVQNRLMVAVHFYDPYEYTLNATYSE
WGHTGAAGKKVSGGDEDNVKNIFGKLKAAYVDKGIPVYIGEMGCVHRATAREESFRKYYL
EYVCKAAKEYGMAPVYWDNGGTGAGKEESGLFNHATGDYLNNAEEIVGVMKKAVFTEDAS
YTLQSVYNNAPQ

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	144	440	9.7e-100	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.31e-55	140	441	11	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.48e-25	123	403	49	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	1.62e-18	9	91	3	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	7.18e-12	35	91	4	60	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.
pfam19190	BACON_2	3.05e-07	15	81	9	79	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60576.1	1.98e-317	2	492	33	512
QUT88430.1	1.07e-278	2	492	32	598
ADY35478.1	7.36e-203	15	492	40	592
AVM57519.1	8.37e-185	121	492	184	563
QRX62664.1	1.63e-182	121	492	138	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	6.46e-191	113	476	19	384	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	1.03e-138	124	492	13	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	8.32e-138	124	492	13	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	6.29e-77	121	455	38	377	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
3ZMR_A	2.48e-62	15	471	17	464	Bacteroidesovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus],3ZMR_B Bacteroides ovatus GH5 xyloglucanase in complex with a XXXG heptasaccharide [Bacteroides ovatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	5.59e-72	121	443	43	372	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
A7LXT7	2.51e-61	15	471	52	499	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
P28621	2.37e-60	117	453	41	355	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P28623	3.46e-60	121	455	46	355	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
Q12647	3.85e-59	121	456	28	347	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_01003.