CAZyme Information: MGYG000002272_01340

Basic Information

• Species: Faecalibacterium prausnitzii_D
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_D
• CAZyme ID: MGYG000002272_01340
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33999.29	5.0623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002272	2829978	Isolate	China	Asia

• Gene Location: Start: 246095; End: 247042 Strand: +

Full Sequence      

MLTITVAQDGSGDFASVSEAVLAVPYACAAEICIGPGVYREKLVCEKQDITLIGAGMEST
RIVWGDGGKLPHPDGRPTHTFRSYTAFFRGTELRVQDLTIENDAGPGAKVGQAVAAYVDC
SHTLFENVRLLGNQDTLFCAPLPEKEREKDGFLGPGRFAPRRPTAQYYRHCEIAGDIDFI
FGGADALFEQCTIRTVNNHLPASYVTAPSGRADGLGFVFWDCDFVSDDCPAGTVFLGRPW
RPTGKTAVLDCRLGGHIAPEGFSAWQSRTDSDLASFAEAGSTGAGAVPRGAWVKQLDSQQ
AEELLRCARKLCRPE

Enzyme Prediction     

No EC number prediction in MGYG000002272_01340.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	304	6.9e-77	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	8.50e-54	6	303	87	395	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	9.37e-49	4	286	2	266	Pectinesterase.
PLN02773	PLN02773	9.07e-45	4	305	7	291	pectinesterase
PLN02745	PLN02745	1.12e-39	4	286	287	551	Putative pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	5.62e-38	2	305	11	281	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81880.1	2.89e-180	1	315	1	314
AXB27671.1	1.15e-178	1	315	1	314
CBL01447.1	1.15e-178	1	315	1	314
QIA44050.1	2.47e-178	1	314	1	313
ATP00222.1	2.47e-178	1	314	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	3.76e-27	6	274	7	253	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	9.91e-25	4	290	9	277	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	1.95e-17	14	302	18	327	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	5.90e-17	37	286	68	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
4PMH_A	1.92e-10	93	261	159	327	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.93e-32	4	301	7	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.74e-30	8	305	90	370	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9LXD9	5.68e-30	4	299	241	530	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1
Q8L7Q7	3.07e-28	4	302	289	584	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
Q9SMY6	4.28e-28	5	278	298	554	Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana OX=3702 GN=PME45 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002272_01340.