CAZyme Information: MGYG000002270_03344

Basic Information

• Species: Enterococcus_A avium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A avium
• CAZyme ID: MGYG000002270_03344
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000002270_40|CGC1	43150.01	4.5992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002270	4464845	Isolate	China	Asia

• Gene Location: Start: 8570; End: 9733 Strand: +

Full Sequence      

MTELPKVRQSEPNGVVYRDDFMNIDFGLIPTGGKATAHAPALIETKDGGMLCAWFAGSFE
GSGDISIAVSKLDPKTQVWSEAKIVSKGEDRSEQNPAFFRAPDGEIWLIYTSQLSRQEGK
DNMQFTSIIMVQKSEDEGETWKEPEVLFDNEGTFSRQAIQVLSNGRWIFSTWLCEDSPDG
LTNDPTEFQVSDDQGKTWKAVRMPDSNGRVHANLIEVEEGHLVAFMRSRFADHVYKSESH
DFGDTWSVPEATMLPNNNASVSAIKLQSGEIALAYNVNAANRAEFGKVAWPGLRNPVAVS
VTEDHGKTWPIGRVFEPAEGYIGIENKTNNSQHEYPTLYQDSNGVLHLVYAYKNRLCVKY
VRFTVEDLFGEKREAEGVYNPTSGEGV

Enzyme Prediction     

No EC number prediction in MGYG000002270_03344.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	32	357	8.2e-38	0.9239766081871345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	3.36e-63	48	348	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.17e-60	31	364	8	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	6.58e-37	36	363	32	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
COG4409	NanH	7.79e-07	134	368	495	726	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15892	BNR_4	6.17e-06	96	214	96	203	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ11920.1	2.27e-293	1	387	1	387
QXJ61186.1	2.11e-271	3	387	4	388
VEI59842.1	2.22e-246	1	387	2	388
QEY07394.1	2.22e-246	1	387	2	388
AWN18553.1	2.90e-244	1	387	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FJ6_A	5.59e-07	4	321	136	486	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002270_03344.