CAZyme Information: MGYG000002268_02211

Basic Information

• Species: Clostridium_AQ sp003481775
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Clostridium_AQ; Clostridium_AQ sp003481775
• CAZyme ID: MGYG000002268_02211
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752		85989.93	5.7035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002268	4827062	Isolate	China	Asia

• Gene Location: Start: 23970; End: 26228 Strand: -

Full Sequence      

MKTDRERIEEDIEAVNLGNLNTVEFDLTLPAYGANGSRITWTSSDTRFLKRNGKVIQPKN
GTGKRMVTLTGKFQYHDVVDEKEYSVTILEQSQKIEASYIYPIHVRAQLNKRTALPSCAI
MITTQGETLSHTVNWMGNEEVCYPACGTYSLKGVLLDNTAEVTAVIEVVEEVSKKLSAQR
KQVTPIQGDVRLLDSDFRDAQNRRLAYLLVQDDDQMLYNFRTACGLDTKGAPAMSGWDHP
DSKLRGHTTGHYLSALAVCYQSVPHPLILHKARYMVQELGLCQQAFEKLEGFQEGYLGGF
DETAYDRLERFSRYPEIWAPYYTMHKYFAGLLDCYELLHIEEALLIARKLGDWVYRRLSR
LSKPQLKTMWGIYIAGEYGGMNEVLARLYLHTRDPHHVKAAQMFDNDRLFVPMQSNVDAL
CGLHVNQHIPQVLGALKIFEGNHVQAYFDIAKNFWHMVIKDHSYANGGIGEGEIFHAPGS
IAAMIDDNTAETCASYNMLKLSAELFAYDPDVAYMDYYERCMINHILASEYQAMEGASTY
FLPMEPGSCKSALDENSCCHGTGMENHFRYPRAIYFHSDEILYINLFVASTMHWGNLQVT
MDLDMCEPQNIHLLIQGEAACEIRIRIPYWTDEVSLLCDGTSLAYTEKQGYICIHKQQEA
MRMQLRFSIYSRLEFTPDDPLVAAVFYGPYLLAALQEGQDYLSTTLSCDTVRQRLQPIPG
TLLFFDEVDQLMYRPLYQLQKEQYHTYIHVKQ

Enzyme Prediction     

No EC number prediction in MGYG000002268_02211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	189	693	2.8e-167	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.92e-126	189	693	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.48e-72	190	706	12	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM13422.1	3.61e-276	4	748	3	748
QNM13425.1	4.91e-270	2	747	3	752
AIQ17696.1	2.41e-240	3	747	6	755
QOS77131.1	3.86e-239	1	748	4	762
ASA23792.1	8.92e-238	3	748	6	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.59e-70	189	693	32	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.24e-64	189	693	32	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5HO0_A	8.91e-07	2	101	550	650	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]
5HO9_A	3.15e-06	2	89	550	637	Structureof truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus],5HO9_B Structure of truncated AbnA (domains 1-3), a GH43 arabinanase from Geobacilllus stearothermophilus, in complex with arabinooctaose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002268_02211.