CAZyme Information: MGYG000002267_04045

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_04045
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40621.97	5.0809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 79822; End: 80904 Strand: -

Full Sequence      

MGKEAITKELEKRRIPELLRLSDNTPVDTPQLWETRRKEIRGILQKECYGYIPESGWETE
WETVSEEENAFGGKARMRTVDVRIRSGRGYVSYPFQLTVPKNIEKPPVFLYLSFFPLSSA
EIVEEITDNGFAVARVSYQDIAPDQNDGFQNGPGSLFPGNAYDSWGKLGVWAWGLSRIMD
YLVQEKMLDAGRAAVVGHSRLGKAALLCGAMDDRFSLVIACESGAGGAALFRGKEGENVA
DLCRNFPYWFCGNFKKWQDREEELPFDQHFTAALAAPRHLYLAGAVEDEWADPLSEFLTG
QAVTPVYEMLGQQGLVADRLPSMGDVFHEGHVGFHLRPGTHYMGRDDWKLFMEYRKKQGV

Enzyme Prediction     

No EC number prediction in MGYG000002267_04045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	15	357	1.3e-79	0.9776951672862454

CDD Domains     

MGYG000002267_04045 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL53565.1	4.76e-130	6	360	4	360
QOV20253.1	1.80e-122	6	360	4	360
AEE95892.1	3.67e-89	14	360	10	362
QDU37053.1	7.31e-80	9	354	36	426
QNK58798.1	1.10e-78	15	357	8	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	3.26e-74	15	354	7	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	5.34e-74	15	354	25	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	8.20e-74	15	354	36	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.50e-73	15	354	25	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	4.19e-73	15	354	25	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	3.46e-59	9	354	36	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
D8QLP9	1.52e-25	15	311	36	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CU53	1.09e-23	14	311	44	338	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
B2ABS0	1.99e-23	33	311	141	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
Q9RLB8	7.61e-22	5	324	371	713	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_04045.