CAZyme Information: MGYG000002267_00499

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_00499
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		32782.35	6.8344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 515769; End: 516620 Strand: +

Full Sequence      

MIEIPKIIHYCWFGENQIPDLAVKCIESWKKYFPDYEIKEWNESNFDFNICNYSKEAYQA
EKWAFVSDYARFWILYHEGGLYFDTDVEVIRSFSDIVGRGAFMGSEKNTMMVSDQGPNNQ
KIVVNPGLGLGVAPGIGLYKEILKYYEKEHFGDKSGKSYVETVVTKTTNILISHGYDPYK
KEIQNVAGIWIYPPEYFSPIDYSTGILTVTPDTHSIHCYMESWLSEAEKKIHNRNRKINS
ILGERVGSKIGWVLERPYYIRKKIKEEGLQGSINRTKEILSGK

Enzyme Prediction     

No EC number prediction in MGYG000002267_00499.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	23	96	1.5e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.69e-17	4	97	82	178	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	6.93e-15	19	96	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.53e-07	1	95	43	142	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	4.49e-04	6	45	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA43512.1	6.43e-102	3	274	5	262
ATP00764.1	6.43e-102	3	274	5	262
ALA75301.1	2.62e-89	4	253	2	239
QJR59783.1	2.62e-89	4	253	2	239
QJR55418.1	2.62e-89	4	253	2	239

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	6.51e-06	4	97	57	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_00499.