CAZyme Information: MGYG000002253_00377

Basic Information

• Species: CAG-533 sp900551105
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-533; CAG-533 sp900551105
• CAZyme ID: MGYG000002253_00377
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920		102687.15	8.3347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002253	1071036	MAG	Peru	South America

• Gene Location: Start: 40078; End: 42840 Strand: +

Full Sequence      

MKKIKIKKRSKKTPKEDNKTISQFKKTFKKGNIAEKILIIIMLFLVVGFALALVFFAYVV
IKAPKFDVESLYTKEASILLDKNGEEFARLGTENRQKVTYDELPEVFIDALVATEDSRYF
QHSGVDMARFLKATIGQVLGQSGAGGASTLTMQVAKQRLTNNEATGIKGIIRKFTDIYLS
VFVLEKQYSKEQIIEYYVNIPYLGGGSWGIEQASQVYFGKSVSQLSLPEAATIAGLFQAP
VAYDPFDYPEKAESRRNQVLNLMKRHGYISEQECEIAKSIPLKSLLIESSSTANQYQGFI
DTVVEEVKKRTGKNPYEVSMQIKTTLNPSKQDAINDIYNGKNYKWINNTVQAAMVVIDND
NGSISAIGAGRNRKRLLEYNYATQIKRHPGSTAKPIFDYGPAIEYLNWSTGKMIIDDKYT
YSGGGYLKNWNNTYMGIMTINTALGTSRNIPALQAFQALTQDQIKTFVTNLGITPEYENG
YINESHSIGGFSGTNPLEMAAAYATFARGGVYIEPYSFTSLEYLDTGEVYTVTPEKRTVM
SEATAFMVNMILKNAVTSNYVAAGSKSGTDIASKTGTSTVDSNYLKNEGIKGNVIGDSWQ
MVYSPDYTISLWIGYKETTKETHLLNEDAGKIKKPMIKLLIKNIMEPNSRWIQPSSVVQA
EIELETEPLALASAATPAKLRSTEYFKKGTVPDEESYRFKQLDNPTNLKADYLQGAVELS
WNNIATPQAIDETFLKTYFDEGYKPWSEKYYNQRLEYNRANIGNIGYHIYVTTNGNTTDL
GFTTNSKYTYTGVLTGKTTFTVKSSYSIFKNNMSSGTTVTVNPEGSVTPEPTNNWTPQLN
GSSTITVSEYYDLKSNNKLVKVLDNGYDVTSSATVTDECYQNNNEVDCKTLSCNESYQVM
HIVTYNGKTKTLNRNLTSGC

Enzyme Prediction     

No EC number prediction in MGYG000002253_00377.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	84	264	1.7e-54	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	5.27e-143	36	615	15	571	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.43e-96	37	719	8	796	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.36e-72	50	614	11	534	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	9.03e-68	83	264	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02071	PBP_1b	1.78e-60	93	599	145	654	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APH04640.1	5.12e-152	30	722	28	714
AWI12666.1	7.08e-149	56	838	53	793
ACJ33515.1	1.30e-144	35	745	29	738
ASA95728.1	2.46e-144	29	745	22	738
QHL55483.1	2.46e-144	29	731	29	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	5.29e-78	79	657	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	8.28e-74	62	657	2	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	7.38e-67	184	632	3	449	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	6.84e-62	184	632	3	449	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2JE5_A	2.26e-44	95	662	54	657	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	1.45e-143	29	731	29	742	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	1.72e-89	56	615	32	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	1.02e-81	56	615	32	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	1.36e-80	56	615	32	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	2.10e-72	67	674	39	627	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999957	0.000061	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	59