CAZyme Information: MGYG000002242_01807

Basic Information

• Species: Treponema_D succinifaciens
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Treponematales; Treponemataceae; Treponema_D; Treponema_D succinifaciens
• CAZyme ID: MGYG000002242_01807
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		39050.57	6.5027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002242	2466093	MAG	Peru	South America

• Gene Location: Start: 10799; End: 11812 Strand: +

Full Sequence      

MKNQIHFFIALFFTVLLCSCGKSFKYAAKDNGFYSGMAVTVGDIFNPETIKILQNDCSII
VYENSMKWANLRPNKNFWNWNDIDSLVEFAEKNNMRVKWHTLFWHQQNSPFVSSSWTREQ
AIQMMNEHIETIMSRYKGKIAEYDVVNEMFNEDGSMRQNIWYKTIGADYIELALKKAHQV
DPDAKLLLNEFNNEEKGHPKADAMYNLVKNLKERGIPIDGVGMQLHLDARISYSEDAIRQ
NIQRYEDLGIAVSFSEVDVRIPIENSKAYESAQENIYLMLYKIASEMPNVTSFITWGISD
KHSWVPSTFPGTGNALLYDKDFKPKPVYNAILKELKK

Enzyme Prediction     

No EC number prediction in MGYG000002242_01807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	27	333	2.2e-94	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	5.79e-117	25	333	2	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	2.41e-95	66	331	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	3.08e-86	15	331	15	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB13140.1	1.27e-251	1	337	1	337
QSI00976.1	1.44e-163	1	337	1	338
AEJ18977.1	5.89e-105	3	328	25	350
ADN02828.1	2.19e-96	7	336	8	340
AEJ62197.1	1.76e-95	7	336	8	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XYZ_A	7.25e-88	21	335	25	344	ChainA, 1,4-BETA-D-XYLAN-XYLANOHYDROLASE [Acetivibrio thermocellus],1XYZ_B Chain B, 1,4-BETA-D-XYLAN-XYLANOHYDROLASE [Acetivibrio thermocellus]
1VBR_A	7.73e-80	50	337	35	322	Crystalstructure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
3NIY_A	8.12e-80	50	337	51	338	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
3WUF_A	6.44e-69	28	331	9	308	Themutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	3.62e-68	28	331	9	308	Thewild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	4.58e-82	21	335	515	834	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
Q60041	4.68e-74	50	331	54	335	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
B4XVN1	1.15e-65	28	331	47	346	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
P23360	2.63e-59	34	335	43	327	Endo-1,4-beta-xylanase OS=Thermoascus aurantiacus OX=5087 GN=XYNA PE=1 SV=4
O59859	6.98e-59	40	335	45	327	Endo-1,4-beta-xylanase OS=Aspergillus aculeatus OX=5053 GN=xynIA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000045	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27