CAZyme Information: MGYG000002241_00100

Basic Information

• Species: UMGS1901 sp900556135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1901; UMGS1901 sp900556135
• CAZyme ID: MGYG000002241_00100
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186	MGYG000002241_1|CGC4	21176.62	5.9639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002241	1320271	MAG	Peru	South America

• Gene Location: Start: 101777; End: 102337 Strand: +

Full Sequence      

MHKYLKITIGVILLIICIIAIKFSNVYNIILKQIYPTKYSDYVEKYAKEYDVDPLLVYSI
IKAESNFNEKAVSTSGAKGLMQLMDATAIEIANKVDEPLAESENLLEPEKNIMIGTKYYA
ELQEKYSGNMLLALAAYNAGIGNVSNWIEQGIVKSDGSNIENIPFKETNMYVRKIINNYK
MYQKLY

Enzyme Prediction     

No EC number prediction in MGYG000002241_00100.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	41	183	4.1e-31	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.99e-67	36	181	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.48e-63	35	185	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.88e-40	54	180	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	4.81e-35	35	186	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	6.96e-30	45	150	3	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU68364.1	4.22e-46	18	186	19	188
ACL76418.1	3.72e-45	31	186	36	191
AEY66639.1	2.12e-44	9	186	15	191
QSZ27862.1	2.62e-43	12	186	9	183
AGB18707.1	4.96e-43	3	186	2	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.01e-22	35	186	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.02e-22	35	186	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.03e-22	35	186	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.04e-22	35	186	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.05e-22	35	186	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	2.05e-26	35	179	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.05e-26	35	179	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	3.83e-25	43	179	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.85e-20	31	176	472	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	1.60e-19	31	176	472	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.735838	0.251570	0.008694	0.000643	0.000393	0.002872

TMHMM  Annotations     

start	end
7	29