CAZyme Information: MGYG000002230_01450

Basic Information

• Species: Ruminococcus sp900545125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900545125
• CAZyme ID: MGYG000002230_01450
• CAZy Family: CBM79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		74891.99	3.9119

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002230	2337720	MAG	United States	North America

• Gene Location: Start: 2720; End: 4801 Strand: +

Full Sequence      

MKKSLFSRVKASATSLVLAVSAVPACLAAPVVNAQTNPDTGLSALKTAGKSMSVDDSASG
TFPEDGAKQITFTIEAEYDQKFTYGLGVAINESPYWTEHNSKGGWDSKGSGFEISLKKGT
NTITVDLSDLDIKPGGEYQFRCYYSAHYDNSVGDMVDNPVTLTKTDFNASAVTPDPDPDP
DPNPGPSFDAKNRKSGDWSFKDNGDGTATISSTVTRELNDLDILLTAGFDEDYYALNPDE
FTEDAPINSHKFSYADFGITEMNGITVESLNVTVESETPFDKFMYGGGMNVKNGSDADTE
YAKRIAGIESKESAGYWYNDMGQEQLDDFVAQGVEFLIDDIGTGTTIEGAGTYFNAYWEP
PKSAQECMSTQLSDTVSFQFWYGTVADTEEYTEAETCTITSAALTYTIERTVPYTGTLSA
VLDSVLDYTDETKQSVEIPYSTLELEKNMDVYAIKFEVTADADIEKFVYGIGTGTNDADN
GYYFQEEGSYVVLEAGKKQEVMWIVPSSISGTNAISNLVNPDGNITVGYYYGTPDTVTLS
GIEVYYEQPQTTTTTTTTTTTTTTTTKKTTTTTTTKKTTTTTTSTTTTTTTSTATTTTTT
TTTTTAPPVEPTVWGDADCDGKVFINDAVLVMQSIGNPDAYGINGTDPSHITKQGKINAD
VYENGTDLTNNDALMIQKFLLNLVSSLDPFAES

Enzyme Prediction     

No EC number prediction in MGYG000002230_01450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM79	428	542	2.3e-21	0.9727272727272728

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18522	DUF5620	3.50e-18	244	405	1	119	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
pfam18522	DUF5620	2.29e-11	430	545	1	119	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
cd14256	Dockerin_I	4.88e-05	615	681	2	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EWM54821.1	4.64e-200	1	689	1	650
CBL17555.1	9.73e-76	70	691	73	615
CCZ83178.1	4.91e-45	69	547	96	673
CAB51934.1	7.70e-18	612	687	436	511
AAB26620.1	7.70e-18	612	687	436	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M2S_B	2.25e-25	612	687	26	101	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]
5M2O_B	1.01e-10	615	684	29	90	R.flavefaciens' third ScaB cohesin in complex with a group 1 dockerin [Ruminococcus flavefaciens FD-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53317	1.54e-18	612	687	436	511	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000496	0.362388	0.636179	0.000633	0.000176	0.000116

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002230_01450.