CAZyme Information: MGYG000002228_01648

Basic Information

• Species: UBA1691 sp900544715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900544715
• CAZyme ID: MGYG000002228_01648
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		51877.95	8.7732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002228	2797749	MAG	United States	North America

• Gene Location: Start: 71447; End: 72814 Strand: -

Full Sequence      

MNIQLNPEKQFQRIEGFGASGAWWAQIVGGWEHIDPASGKPVRDRISEMLYSREKGIGLQ
IYRYNIGGGSKRSGKGRFSQPARRADSFDAGDAQYDWSRDAQAVYMMRQAVRDGAGEIVL
FVNSPPERLTKNHKTHVGLFRSFQENLSRKNYDAFVRYCLDVTEHFVEEGLPVKYLSPIN
EPVWVWNGGQEGCHYHPSSAGRLFQTFARALEDRDALQMVKLAGMEVGDIRWFNKAYTRR
LLKDPLVRRHLDSVDIHSYFHPVPLPFCNNRIAFLKRFRRWMDQQYPGMPVKMSEWTHMQ
EGRDRGMDSALVMARTMVEDLSIMQVTSWQHWIAVSEVDFCDGLIYIDLETKTFEPTKRL
YATGNFSRYLQPGARRIDASCASPELKVLAFQQGGQTVLIAVNFSQSAQKVTVSPNPHSR
MKLAVTDASHDLAESWVEAGEALALSPRSVNTLVF

Enzyme Prediction     

No EC number prediction in MGYG000002228_01648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	2	454	3.7e-105	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	3.19e-52	3	346	4	367	O-Glycosyl hydrolase family 30.
COG5520	XynC	4.19e-13	2	454	35	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93176.1	1.69e-123	1	454	58	512
BCJ99845.1	1.67e-121	1	454	60	515
BBC60194.1	2.01e-115	1	454	45	489
BAL61330.1	2.01e-115	1	454	45	489
AUJ86440.1	8.23e-107	3	453	44	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.89e-34	5	454	10	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5CXP_A	2.12e-14	5	440	8	355	X-raycrystallographic protein structure of the glycoside hydrolase family 30 subfamily 8 xylanase, Xyn30A, from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6IUJ_A	7.10e-14	3	434	24	446	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	8.35e-14	3	434	95	517	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
1NOF_A	2.09e-12	3	454	3	381	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	5.10e-12	3	454	29	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002228_01648.