CAZyme Information: MGYG000002227_00439

Basic Information

• Species: Eubacterium_R sp900546785
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900546785
• CAZyme ID: MGYG000002227_00439
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		72606.92	4.2139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002227	2038651	MAG	United States	North America

• Gene Location: Start: 127247; End: 129226 Strand: -

Full Sequence      

MKAIKKIAGAINSRTGSFIFFSLAAAAFTFFYSSDWAYGWIAELYPLGEGFITLMLCLTG
ICAGISLISLFINAFNMKGKAAKAFGFIHILFAVISVIAFIYTFVLLFGIDQGFSAAGFS
RGFSSLMPNIGYLGAALAIALVIAVAQTSKRAVKAVIACVIIAALVISPTAFSGISGANA
GTLPQITLESEELMDGAKIIYESLKKGEKADAANLLTDGEECWTAQDPDGMPEEGFPDIT
GSYVEIQLNGEKTFNTAIIEEIGNEAQYFRLMALIDGEWTLLYQSEKIQQQRLCSFDAVT
TDRIRLCIDKFRSTDTPVKIRSIKLYNEPKRDAGDFEVTAYQRLDGDVPTEILARGDEYV
ANYARFYDVYSTIIVFGAVHWDENGNMGFGDGGEEQFAREIAALKEIISRRSNPEHEVKL
VITALADGTWGDEHNGVNAYMSAYWESIADKIADFTAKYGFDGVDIDWEYPQSAADWECY
DNFIARLDDRLHQTDPNAILTAALSSSALGMSRETLERLDQIQFMAYDGNDEDGYQSSLQ
QAQEGIQAFIDNGADISKINIGIAAYGRPVDLAPYWATWRDLDEANYWDNKYYNVHDLDQ
VYEGTFCSPALAGDKTAYALFAGCGGVMVFRVGCDKTMDDPNSVACGIENALNRYFTEW

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	378	642	2.7e-31	0.8614864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	3.41e-22	372	630	24	302	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	9.34e-20	362	628	30	315	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	5.58e-19	361	635	10	334	Glyco_18 domain.
cd00598	GH18_chitinase-like	1.19e-16	372	528	25	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06545	GH18_3CO4_chitinase	5.36e-14	359	567	4	209	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI70669.1	4.30e-17	451	644	111	311
QDT54879.1	1.29e-15	462	654	140	318
NP_001034515.1	1.12e-13	372	653	52	384
AAW67570.1	1.12e-13	372	653	52	384
AAW67571.2	1.49e-13	372	653	52	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	5.90e-10	381	644	90	415	ChainA, Glycosyl Hydrolase [Niallia circulans]
6EPB_A	7.07e-08	421	636	124	384	Structureof Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
3G6L_A	2.74e-07	421	640	107	371	Thecrystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
1GUV_A	9.95e-07	446	573	96	253	Structureof human chitotriosidase [Homo sapiens]
3ALF_A	1.26e-06	410	567	60	236	CrystalStructure of Class V Chitinase from Nicotiana tobaccum [Nicotiana tabacum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	5.10e-09	381	644	122	447	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P48827	3.87e-07	421	636	124	384	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
Q5AM60	6.14e-07	404	568	89	264	Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT4 PE=3 SV=1
P32470	2.07e-06	421	640	124	388	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
A6N6J0	8.49e-06	421	636	125	391	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41
51	73
86	108
123	145
152	174